KEGG   Candida orthopsilosis: CORT_0B02870Help
Entry
CORT_0B02870      CDS       T02488                                 

Definition
(RefSeq) Msm1 mitochondrial methionyl-tRNA synthetase (MetRS)
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cot  Candida orthopsilosis
Pathway
cot00450  Selenocompound metabolism
cot00970  Aminoacyl-tRNA biosynthesis
cot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CORT_0B02870
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CORT_0B02870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cot01007]
    CORT_0B02870
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cot03016]
    CORT_0B02870
Enzymes [BR:cot01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CORT_0B02870
Amino acid related enzymes [BR:cot01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CORT_0B02870
Transfer RNA biogenesis [BR:cot03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CORT_0B02870
 Prokaryotic type
   Other AARSs
    CORT_0B02870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 SYCP2_ARLD HAP1_N Pox_D5
Motif
Other DBs
NCBI-GeneID: 14538765
NCBI-ProteinID: XP_003867439
UniProt: H8X0W2
Position
2:complement(598690..600417)
Genome map
AA seq 575 aa AA seqDB search
MKLRYSLLFKRYSSSKPLYITTPIFYVNAAPHIGHLYSMLIADTRSRWERLNPSRSAYML
TGTDEHGLKIQNTAEKLGIEPKELVDKVSTNFKSLASQLNIKYDRFIRTTDLDHVEVAQH
FWNLMMEKGYIYKGTHSGWYCISDETFYPESSIEEVEKDGKIIKISVESRNEVVYETETN
YFFKLSSFQKDLIEVLKQKPYFIKPNHRYKFILNELMTSELPDLSVSRPSSRLKWGIEVP
NDSSQKIYVWFDALLNYLTATGFPKRFKQDGTGFITPENNPWPATHVIGKDIIRFHCIYW
PIFLMAAEIELPKQVIVHSHWLCEGFKMSKSLGNVVDPMELSEYYGVDPVRFFLTENSNI
DDDCKFSEALLQRSRDALVGKYCNLLSRIGGKSFDIAQAVKQANSGEFEKIDELINQYSL
KKENIDSVLQLSKELQENLNNSYQEMNEKFTNFDYIRAIQVWWKAINQANQLFQMAEPWL
YVSAIRDSQVSEETAHQYQLLVNYFVYLCSETIRIMSILIQPVMPHLSDQILTRLNVIPE
RRNCGFTKVGADLDYGEDANSTSYKPPLQKIKSRV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacgatactctttactattcaaacgatatagtctgtccaagccactttacatt
accacacccatattctatgtcaatgcagctccacatataggtcatttgtattcaatgcta
attgcagataccagatcccggtgggagaggttgaacccttctagactggcctacatgttg
actggtactgatgagcacgggttgaagattcagaatactgcagaaaaactaggtattgag
cccaaggagttggttgacaaagtttccaccaacttcaaatcactagcatcacaattgaat
attaaatatgatagatttattcgaactaccgatttagatcatgttgaagtagcacaacac
ttttggaacttgatgatggaaaagggatacatctacaaaggaacgcatagcgggtggtat
tgcattagtgacgaaacattttatcctgaatcaagtattgaagaagttgaaaaagatggt
aaaatcattaaaatttcagttgagtcaagaaatgaggtggtatatgagacagaaaccaac
tactttttcaaactttcatcatttcaaaaggacttgattgaagttttgaagcaaaaacct
tactttattaaaccgaaccatcggtacaaatttatcctcaatgagttgatgacgagtgag
ttgccagatctttcggtttcccggccttcttcacgattgaaatggggtattgaggtaccc
aatgattcatcgcaaaagatttatgtttggtttgatgcgttattgaactacctcactgcc
actggattcccaaagagattcaaacaagatgggactggatttatcacccccgagaataac
ccctggccagcaacacatgttattggaaaagatataatacgattccattgcatttattgg
cccatattcctaatggctgctgaaattgaactaccaaaacaggtcattgttcattctcat
tggttgtgtgaaggtttcaaaatgagcaaaagtttgggtaatgtagttgatccaatggaa
ttgagtgaatattatggggtggatccagttcgattctttttaacagaaaattccaatatt
gatgatgattgtaaatttagtgaagctttattgcagaggagtagagatgcacttgtgggg
aaatattgtaatttgttatcaagaattggtggtaagctgtttgatattgctcaagcagtg
aagcaagctaatagtggtgagtttgagaaaattgatgaattgattaatcagtatagcttg
aaaaaggaaaacattgattcagttttgcaattgtcaaaggagttacaagagaatctcaac
aattcttatcaagaaatgaatgaaaaatttactaatttcgactacatacgagcaatccaa
gtttggtggaaagcgattaatcaagctaatcaattgtttcaaatggctgaaccatggcta
tacgtgtcagcaatcagagactcgcaagtaagtgaggaaacagcacatcaatatcaattg
ttagtcaactatttcgtttatctatgctcggaaacgatacgtatcatgtcgatattgatt
caaccagtgatgccgcacttgtcggaccagatcttaactaggttgaatgtgattccagaa
aggcgtaattgcggtttcaccaaagttggtgctgatttagactatggtgaggatgccaac
tccactctgtataaaccacctttacaaaaaattaagtcaagagtatga

DBGET integrated database retrieval system