KEGG   Candida orthopsilosis: CORT_0B08000Help
Entry
CORT_0B08000      CDS       T02488                                 

Definition
(RefSeq) Dst1 protein
  KO
K03145  transcription elongation factor S-II
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cot03021]
    CORT_0B08000
Transcription machinery [BR:cot03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     CORT_0B08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 YceG Elf1 Baculo_LEF5_C
Motif
Other DBs
NCBI-GeneID: 14538418
NCBI-ProteinID: XP_003867941
UniProt: H8X1U9
Position
2:complement(1674362..1675264)
Genome map
AA seq 300 aa AA seqDB search
MDAKEIKSTISNLEKSVDDITILKLLNILNDEVVPTEKLLRETKVGVVVNKYRSHDNKDI
STLVKKMIRGWREAVQNEKNSKKKPSAGSPESTPASSGSPASTTLNADKSGASAANGRTF
SGPRNAKSDGVNTTLYDNPTRNASVGALYSSLAVERDDSPQHIITIASEIESEVFKSEYS
KVNDAYRNKLRSFTMNLRNKKNPELRERVLSKQITASQFIKMTPNEMAPEALKKEIEKLH
KQNLFDAQGATEKRAVTDRFTCGKCKHKKVSYYQMQTRSADEPLTTFCTCENCGNRWKFS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggatgccaaggaaataaagtccaccatatcgaaccttgaaaaatctgtagatgatata
acaatattgaagctactcaatattttaaacgatgaggttgtacccactgaaaagttgttg
agggagacaaaggttggtgtcgtagtcaacaagtacagaagtcatgacaacaaggatata
tcaaccttagtgaagaaaatgattaggggatggagggaagcagtgcaaaatgaaaagaat
agcaaaaagaagccctcggctggctcgcccgaatcaacaccagcatcttcgggatcccct
gcatccacaacactaaatgcagacaagtcaggagccagtgcagctaacgggagaacattt
agtggaccaagaaatgcgaaatccgatggggtaaacactacattatacgataatcccact
cgtaacgcatctgttggagcgttatactcttccttggctgtcgagagggacgactctcct
caacacatcattacaatagcctctgagatagaaagtgaggtgttcaaaagtgagtacctg
aaagtcaacgacgcttacagaaacaagttaagaagtttcaccatgaatcttcgaaataaa
aaaaacccagaattgagggaacgtgttttatcaaaacaaattacggcttctcaattcatc
aagatgacacccaatgaaatggctcctgaagcattgaagaaagagattgaaaagttgcat
aagcaaaacctctttgacgcacaaggtgccactgaaaagagagcagttactgatagattt
acatgtggtaaatgtaagcataaaaaggtgagttattatcaaatgcaaaccagatctgcg
gacgagcctttaacaacattctgcacatgtgaaaactgtggaaatagatggaaattttcg
taa

DBGET integrated database retrieval system