KEGG   Candida orthopsilosis: CORT_0C04770Help
Entry
CORT_0C04770      CDS       T02488                                 

Definition
(RefSeq) Thi4 thiamine biosynthetic enzyme precursor
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
cot  Candida orthopsilosis
Pathway
cot00730  Thiamine metabolism
cot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CORT_0C04770
Enzymes [BR:cot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     CORT_0C04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 Lycopene_cycl NAD_binding_9 FAD_oxidored HI0933_like FAD_binding_3 GIDA Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 14539813
NCBI-ProteinID: XP_003868755
UniProt: H8X2Z1
Position
3:complement(1085047..1086108)
Genome map
AA seq 353 aa AA seqDB search
MTPPTMLQTTTTETFHLTPSGNRQINLKSNAANGEVKFADWEKFQFAPIRESTVSRAMTR
RYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPDLKIAIIEASVSPGGGCWLGGQLFS
AMVLRKPADQFLDNLGVAYEDEGDYVVVKHAALFMSTLLSKVLQFPNVKLFNATAVEDLI
TRRDESTGELRIAGVVTNWTLVALNHDTQSCMDPNTINCNVVLSTTGHDGPFGAFSAKRL
EELGKAPKDITVGFKPSGEQQPTQTNSASVFELGGMRGLDMNKAEDAIVKGTREIVPGLV
IAGMELAEVDGSNRMGPTFGAMALSGVKAAESVLNAIDIRQKQNQTCYGGLKA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactccaccaactatgttacaaactaccacgactgagacattccacttgactccaagt
ggaaaccgtcaaatcaatttgaaatccaatgcggctaatggcgaggttaaatttgctgac
tgggaaaaatttcaatttgctccaattagagaatcaactgtttccagagcaatgaccagg
aggtactttgctgacttggacaaatacacagaatcagacgttgttattgttggtgctgga
tctgctggtttatctgctgcatatgttttggccaagaacagaccggatttaaagattgct
attattgaggcatcagtttccccaggtggtggctgttggttgggtggtcaattgttctcg
gccatggtgttgagaaagccagctgaccagttcttggacaacttgggtgttgcttatgaa
gacgaaggtgattacgttgtcgtcaagcacgctgctttattcatgtcaaccttactttca
aaggttttgcagttccccaatgtcaaattgtttaatgccaccgctgttgaggatctaatt
acaagacgtgatgaatccactggggagttgagaattgctggtgttgtcaccaactggaca
ttggttgcattgaaccatgacactcaatcatgtatggacccaaataccatcaactgtaac
gtggttttgtctactactggccacgatggtccttttggtgccttctctgctaagagattg
gaggagttgggaaaagctccaaaggacatcaccgttgggttcaaacctagcggtgagcaa
cagccaacacaaaccaactctgcatctgtttttgaattgggaggcatgagaggtcttgac
atgaacaaagcagaagatgccattgtcaaaggaacaagagaaattgttcccggtttggtg
attgctggtatggaattggctgaagttgatggttccaacagaatggggcctactttcgga
gccatggctctctccggggtcaaagccgcagaatctgtgttgaatgcaattgacatcaga
cagaagcaaaaccaaacttgctacggtggtttaaaagcctga

DBGET integrated database retrieval system