KEGG   Candida orthopsilosis: CORT_0C05300
Entry
CORT_0C05300      CDS       T02488                                 

Definition
(RefSeq) Erg24 C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cot  Candida orthopsilosis
Pathway
cot00100  Steroid biosynthesis
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
Module
cot_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CORT_0C05300
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CORT_0C05300
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 14539799
NCBI-ProteinID: XP_003868808
UniProt: H8X344
Position
3:1228122..1229555
AA seq 477 aa
MITISFFFTIISAYINTEHHQLSIIQLHAKTNLKQAMSTLNPATTHREFNGLSGALGITF
GLPFVIIFFALVTNQYYSLQGIHIQIDKILSQIPSNQSEWIDLCFDKQVWSAYLAWFFGL
VILDQILPGKMMEGTKLRDGTYLSYCINGVSMSGTLFTILIARCFQVVDFNLPELQFIYD
HQLQLSVTCIIFSFLLAVFVYVYSFIPLTKVNGVGTKERILSVNGNTGNPIYDWFIGREL
NPRIGNWDIKLFCELRPGMLLWFLINLSCAHEQYHRLGHVTDSLILVTLLQTFYIFDGVL
NETGLLTMIDITTDGFGFMLSFGDLAWVPWSYTLQTRYLSIPGNEVILGWCNFAAIVVLH
FVGFYIFRASNLQKSNFKNGKLEHMKHIKTATGSRLLIEGWWGLSQHINYLGDWLIGWSW
CLPTGFQTPLTYFYVIYFASLLIHRQVRDDMKCQAKYGKDWEKYKQLVPYKIIPYIY
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgattacaatttcttttttttttacaatcatttccgcgtatataaacacagaacatcac
cagcttagcataattcaactacatgcaaagactaaccttaagcaagcaatgagtacattg
aacccagccacaacgcatagagaatttaatggtctttctggagcattaggtataactttt
ggtttaccttttgtaatcatttttttcgctttagttaccaatcaatactattcattacag
ggtatccatattcaaattgataaaattttgagccaaattccatcaaaccaatctgaatgg
attgatttgtgttttgataagcaagtttggagtgcatatttagcttggttctttggattg
gtcattttagatcaaattttgcctggaaaaatgatggagggaactaaattgagagatgga
acttatttgtcctattgcatcaatggtgtaagtatgagtggaacgttgtttactattttg
attgctcgttgtttccaagtggtggatttcaatttacctgaattacagtttatttacgat
caccaattacaattgtcagtgacatgcataattttctcctttttgttggcagtctttgtt
tatgtatactcgtttatcccattgacaaaagttaatggtgttggaacaaaggagaggata
ttgagcgtcaatgggaatacagggaacccaatttacgattggtttatcggtcgtgaatta
aacccaagaatcggtaattgggatatcaagttattttgcgaattgagaccaggaatgttg
ttatggttcctcatcaatttgagttgtgctcatgagcaatatcatagattgggccatgtc
accgactctttgatattagttactttattgcaaacattttacatttttgatggtgtgttg
aatgaaactggtttgttgacaatgattgatattacaactgatggttttggatttatgttg
agctttggtgatttggcatgggtgccttggagttataccttacaaactaggtatttaagc
attccaggtaacgaggtcatattaggatggtgcaattttgcagccatagtggtgttgcac
tttgtcggattctacattttcagagcttctaatttacaaaaatccaacttcaaaaatggc
aagttggaacatatgaaacatatcaagactgccacagggtcaaggttgttaattgaagga
tggtggggtttgtcgcaacacatcaactacctcggtgattggttaattggatggtcttgg
tgcttacccactggattccaaacaccattaacatacttttatgtgatatattttgccagt
ttattgattcatcgacaagtgagagatgatatgaaatgccaagccaaatatggtaaagat
tgggaaaagtacaaacaattggttccgtataaaattattccttatatatattag

DBGET integrated database retrieval system