KEGG   Candida orthopsilosis: CORT_0C06560Help
Entry
CORT_0C06560      CDS       T02488                                 

Definition
(RefSeq) calmodulin-dependent protein kinase
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cot01001]
    CORT_0C06560
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     CORT_0C06560
Protein kinases [BR:cot01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   CORT_0C06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal DUF3829 YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 14539483
NCBI-ProteinID: XP_003868933
UniProt: H8X477
Position
3:complement(1465140..1466474)
Genome map
AA seq 444 aa AA seqDB search
MTASIKSSEAQAEGSHLKNFVNKIIGQPASYSHKQNYTFGKTLGAGSFGIVRYARNNVTG
EDVAMKIILKKALKGNEAMVLEEIKLLEELHNPHIVGFRDWFESKDKFYIATQLATGGEL
FDRIVQQGRFTEHDASLVIIQMLEALQYLHERDIVHRDIKPENVLYLTPETDSQIVLADF
GIAKRLQNSSEKLMSSAGSFGYAAPEVILGTGHGKSCDIWSLGVVTYTILCGYSPFRSEN
VTDFINEVKHNNAVIFHADYWRDVSKDARRFIIKTLQYNPDNRPTATELLNDPWIVSIAK
KHTDADLLPQLKERFDAKAKFRQAIELVKLHNRINKLKEMQTEEDDDPTEINMFNANGDL
SRESTKKTDGDSTQGSALSNWKKFNDSLKVAEGDADRSKVSLSDTTPKPKDNAPKTTAAG
NAFVQLVHAASKNKERVESYKDKD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgtcaataaaaagctcagaggctcaagctgagggaagtcacctcaaaaacttt
gtcaacaaaatcattggtcaacctgcttcctattcccataagcaaaactacacatttggt
aaaacattgggcgccggctcatttggtattgtgaggtatgccaggaataacgtcaccgga
gaagatgtagcaatgaagattatattaaagaaagcattaaagggaaacgaagcaatggtg
ttggaggagattaaattgcttgaagagttacataacccccacattgttggatttagagat
tggtttgaaagcaaagataaattttatattgcaacacaattggccaccggtggtgaatta
tttgatcgaattgtgcaacaaggtagattcactgaacatgatgcttcgttggttataatt
caaatgttggaagctttgcaatacttgcatgaacgtgatattgttcatcgcgatattaag
ccggaaaatgtgttatacttgaccccagagacagacagtcagatcgtgttggcagatttt
ggtattgctaaacgattacaaaactcaagtgagaagttgatgtcatcagctgggtccttt
ggatatgcagcaccagaagttatattaggaactggacatggtaaatcatgcgatatttgg
tccttgggagttgtcacttacaccattctttgtggttattcaccattcagatcagaaaac
gttactgatttcataaatgaggtgaagcataataacgctgtcattttccatgctgattac
tggagagatgtttctaaagatgctcgtagatttatcatcaaaacgttacagtataatcct
gataatagacccacagcaactgagctattgaatgatccatggattgtatctattgctaag
aaacataccgatgctgatttgttgccacaattgaaggagcgtttcgatgccaaggccaaa
ttcagacaagctattgaacttgttaaattacacaacagaatcaataaattgaaggaaatg
caaaccgaagaggatgatgatccaacagagattaacatgttcaacgccaatggagatttg
ctgagagagctgactaaaaagacagatggggattcgacccagggctcggctttgagtaat
tggaaaaagtttaatgactcgttgaaggtagctgaaggagatgcagatcgatcaaaggtt
tcgttatctgataccactcctaagccgaaggacaatgcgccaaagacaacggctgctggt
aatgcatttgtacaattagttcatgctgcttcaaaaaacaaggagagggtagaaagctac
aaagacaaagactga

DBGET integrated database retrieval system