KEGG   Candida orthopsilosis: CORT_0D03900Help
Entry
CORT_0D03900      CDS       T02488                                 

Definition
(RefSeq) Vps41 protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
cot  Candida orthopsilosis
Pathway
cot04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cot00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CORT_0D03900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cot04131]
    CORT_0D03900
Membrane trafficking [BR:cot04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    CORT_0D03900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin Protocadherin WD40 Vps39_1
Motif
Other DBs
NCBI-GeneID: 14540265
NCBI-ProteinID: XP_003869365
UniProt: H8X5Y2
Position
4:complement(755607..758786)
Genome map
AA seq 1059 aa AA seqDB search
MGIGSFARIINFFRLKPHFKESKFEFINRRHTPNNDHWDIMASKKKNKTQKNGGDKNLAA
IGIVDIHQEDHKGKWHDAQEEDIAHENDTNVDFGSPVVNEEGNYSSSSPQQSQNKSDTKG
KEDLDEIEAEESNAQNKVIDNDEEGSSDVEQEQDEDEEDEPPKLKYSRINQLPSNFFTKD
PVSSCFFHDKYFIFATHSGFIHICTNNFTAVRTFKAHRASVLSTYTDGQFFASASMDGTV
VIGSIDDEKDIIAYDFQRPVHVVVLDNNYASKRSFISGGMSGKVIYSRKNWLGKKADYII
DQNNGAIVGLTIVGDLVIWMNDKGINVFHLSNRALIKVLEKPSDSPRNDLYWPRVAQPDS
DRLIIAWSNYIWSLRISLKDGSTSDIKDQDSVPVLSSGMSRILPSTASISFRATQEKKVE
VEHIFKLDDLICGIASYKDDLWIVLTYEPPVRKPFGEANGGKATDNNPDLKLINSTTGEV
EFEEELALKNIQNLGLNDFTLGSHIDQVPKYFIISAKDGVVAQEYQLHDRLQWYLMKEDY
LRAYEVSEHIVSPVKRMSFGVQYVDSLVKVDEWVKAADFLRSLLPLKEETTVDEQTSSPD
EDAVAIDSGLHPKDEMRSEIISQWQTWAHIFINSGHIDILSNVIPSVSTLPAELFTKILI
YWIANEPRKAYELICKWPIELYEVATVESELKKRESGLGDNNGERYSLVEGTLVKLYDKK
LQPLKAVPHLVKLKDKNIVEYLSRNHILKNFVPQLPTFIELQFDNPDAISKWPIDTLGEK
LSPTIDILVDHRLEIPSHDIVELFKSHPHLSFINFFYLTRLQAIDKLLVRDYGDELIELY
SNYSRRDLLPFLMANDENDATQSTYDVDGAIEICQQNNFYQELIYLLGKIGENKQALNLV
INKLDDPQMAIEFAKRLNDKDTWNSLINQSLDKPKFLKILIEQSDESTNPFYDPVSILTK
IATKFDAGLVGEDNGELDEVHAHIYRQLSQSIIEFSKNNDLNKLINQVVLKMIDQSSQEI
SQFLKQSLLQGRQYDMEKNDKTSRRIANSLQNWEPITLN
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgggaattggactgtttgcaagaatcatcaatttttttcgattgaagccgcattttaaa
gaatccaagtttgaatttatcaacagaagacatactccaaacaatgatcattgggatata
atggccagtaaaaagaaaaacaagacacagaaaaatggtggtgataagaatttggcagct
ataggtatagttgatatacaccaagaggatcacaagggtaaatggcatgatgcacaagag
gaggacattgcacacgaaaatgatacaaatgtggattttggcagtccagttgtaaacgaa
gaaggaaattattcatcatctagtccacaacaaagtcagaacaagtcggatacaaagggc
aaagaggacctagacgaaattgaagccgaagagtcgaatgctcaaaataaagtaattgat
aatgatgaagagggaagctctgatgtcgaacaagaacaggacgaggacgaagaagatgaa
ccaccaaaacttaagtactcacgtatcaaccaactaccgagtaacttctttaccaaggat
cctgtatcttcatgcttcttccatgataaatattttatatttgctacccattctggtttt
attcacatatgcacaaacaacttcactgctgtccgtacattcaaagctcatcgagcatct
gttttgagcacatacacagatggacagttttttgcatccgcttccatggacgggactgtt
gtcataggttccattgatgatgaaaaagatatcattgcgtatgattttcaaagacctgtg
catgtagtagtactcgataataattatgcatcaaagaggagtttcatcagtggtggaatg
agcggtaaagtcatctattcaagaaaaaactggctaggtaagaaggcagattatattatt
gatcaaaataatggagccattgtcggtttgacaatcgttggtgacttggtcatttggatg
aatgacaagggaatcaatgtgtttcatttgagtaatagagcgttgatcaaagtattggag
aaaccaagtgatagcccaagaaatgacttatattggccgagggtagcgcaacctgactct
gatagattaattattgcatggagtaattacatatggtctttgcgaatatcattgaaggac
gggtcaacactggacataaaggatcaagattcagtgccagtactttcatcagggatgagc
aggattttaccatccactgcttctatttcctttcgagccacccaagaaaagaaggtagaa
gtagagcatatttttaaactagacgacttgatttgcgggattgcaagctacaaagatgat
ttgtggatagtccttacttatgagccaccagtacgaaagccatttggcgaagcaaatgga
ggaaaagcaacagataataatcctgatttgaaattgatcaactctacaacaggagaggtg
gagtttgaagaggagctagctttaaagaatatccaaaatttgggattgaatgattttaca
ttggggtctcacattgatcaagtgccaaagtattttattatcagtgccaaagatggagtt
gttgcacaagaataccagttacatgataggttacagtggtatttgatgaaggaggattat
ttacgagcctacgaggtgagtgaacacatagtgtctcccgtgaaacgaatgagctttggt
gtccagtacgttgacctgttggtaaaagtggatgagtgggtgaaagctgctgattttttg
aggtctttgttaccgttaaaagaggaaacaacagtggatgaacaaacaagcagccccgat
gaagacgcggttgcaattgattctggactccatcccaaagatgaaatgcgaagtgagatc
atcagtcaatggcaaacatgggcacatattttcatcaacagtggacacattgacatattg
agtaatgttataccaagtgtttcgacattgcccgcggaattgttcacaaagatattgatt
tattggatagcaaatgaaccacgaaaggcgtatgaattgatttgtaaatggcctatcgag
ttatatgaagttgcgacagttgagtctgagttaaaaaagcgggaatcaggtttgggagac
aataatggtgaacgctatagcttagttgaaggaacacttgttaagctttacgataaaaag
ctccaaccactcaaggcagtacctcatcttgtgaaattaaaggacaaaaacattgttgag
tacttgtcaaggaatcatattttgaaaaattttgtacctcaattacccacattcatcgaa
ttacaatttgataaccctgatgccatttcaaaatggccaatagatacacttggagagaaa
ctatcaccaacgattgatatattggtagatcaccgcctcgaaattccatcccatgatatc
gttgaattgtttaaatcccatccgcatttgtcatttatcaatttcttttacttaacccga
ctacaagctatcgataagctattggtgagagattacggggacgagcttattgagttgtac
tcaaactactcacgtcgggacttacttccgtttctcatggccaatgatgaaaacgatgcg
acccaaagcacttatgatgttgacggggccatcgaaatttgccagcaaaacaatttttat
caagagttgatttatttgttgggcaagattggagaaaataagcaagcgttgaacttggtg
attaataagctagacgatccacaaatggcgattgaatttgccaagaggttgaatgataaa
gatacctggaactctttgattaatcagtcgttggataaacccaagtttctcaagatcttg
attgaacaatcggatgaatctacaaaccctttttacgatcctgtgagtattttgactaaa
atcgcaaccaaatttgacgcaggattagtaggtgaagataatggtgaattggatgaagta
catgcgcatatataccgacaattgagtcaaagtataattgaattttcaaaaaacaacgat
ttgaataaattgataaaccaggttgtattgaagatgattgatcaaagttcgcaagagatc
tctcagtttttgaagcagtctctattgcagggacgacaatatgacatggaaaagaatgat
aaaacttcaagaagaattgctaacagtttgcaaaattgggagccaataacattaaactaa

DBGET integrated database retrieval system