KEGG   Candida orthopsilosis: CORT_0D04320Help
Entry
CORT_0D04320      CDS       T02488                                 

Definition
(RefSeq) Pre6 alpha-4 subunit of the proteasome
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
cot  Candida orthopsilosis
Pathway
cot03050  Proteasome
Module
cot_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:cot00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    CORT_0D04320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cot01002]
    CORT_0D04320
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cot04131]
    CORT_0D04320
   03051 Proteasome [BR:cot03051]
    CORT_0D04320
Enzymes [BR:cot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     CORT_0D04320
Peptidases [BR:cot01002]
 Threonine Peptidases
  Family T1: proteasome family
   CORT_0D04320
Membrane trafficking [BR:cot04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    CORT_0D04320
Proteasome [BR:cot03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    CORT_0D04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 14540372
NCBI-ProteinID: XP_003869407
UniProt: H8X624
Position
4:complement(join(840124..840841,840940..840974))
Genome map
AA seq 250 aa AA seqDB search
MSGYDSALSIFSPDGHVFQVEYASEAVKRGTCAVGVKGKNIVVLGCERRTTLKLQDPRTT
PSKICKIDHHILLAFAGLNADSRILIDKARVEAQSHRLNLEDAVSVEYLTKYVAGVQQKY
TQSGGTRPFGIATLIAGFDTNDTVPKLYQTEPSGVFNAWKAHAIGRSAKTVKEFLEKHYK
DDANDEDTIKLTVKSLLEVVQTGAKNIELSVMKPGGVIEKLTIDEIKKYVDEIEAEKEAE
AEKKKPKSRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatacgacagtgctttatctatattctcacccgatggacatgttttccaagtg
gaatacgcatccgaagcagtcaagagaggtacatgtgctgtaggagtcaagggcaaaaac
attgttgtattaggttgcgaaagaagaaccactttaaaattacaagatccaagaaccacc
ccatctaaaatatgcaaaattgatcatcatatattattagcgtttgctggattaaatgct
gattcaaggatcttgatagataaagcaagagtagaagcacaatctcatcggttaaattta
gaagacgctgttagtgttgaatacttgactaaatatgttgctggtgtacaacaaaaatac
actcaatcagggggaactaggccttttggaattgctactttgattgctgggtttgatact
aatgatacagtacctaaattgtatcaaactgaacctagtggtgttttcaatgcttggaaa
gcccatgctattggaagatcggccaagactgtaaaggaatttttggaaaagcattataag
gatgatgctaatgatgaagatacgattaaattgactgtgaaatcattgttggaagttgta
cagactggtgcaaagaatattgagttgtctgtaatgaaaccaggtggtgttattgaaaaa
ttaactatagatgaaattaagaaatatgttgatgaaattgaggctgaaaaggaagcagaa
gcagaaaagaagaagccaaaatcaagagattag

DBGET integrated database retrieval system