KEGG   Candida orthopsilosis: CORT_0D04350Help
Entry
CORT_0D04350      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIA
Motif
Other DBs
NCBI-GeneID: 14540375
NCBI-ProteinID: XP_003869410
UniProt: H8X627
Position
4:844309..845490
Genome map
AA seq 393 aa AA seqDB search
MRGYGGGYSSYGRSSYGGSYGSSRYGSSRYGSGRYGSSSYGSSRYGGSGSYDGRSSSNRY
SGYYTSPTSKQQQPQSNKGNYSSQTSNQKPKNSYGKSNGQQYKQPQPYQNYPQNQYNQGS
SNDNSKYNNGSKQNYSNSNSRYRYKNQTVKNKTINQNTNVNQQQQQHRGRFGRFGGGFGR
MMRWPLMFMMFDRFRRPRHEPVPMQQPQPQHPPVINVYNPPHDQQTRDNANQETGDTGYN
SQVHNETGAFNRGIDEPHDDKPLSREADLTPSSPLAPPLDANKNDSRLIKDTTTTTRVKV
TRTKSEPNRLRELSHTPTIEPVSSNASSARLGGEGGGGGDNNLDIHELRGYHTNEIPNLQ
TRTRSSNKDLSRGLSNQTIGLQSILRQFPSQEV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagaggttacggtggcggttatagcagctatggtagaagcagttatggaggcagctac
ggcagtagtagatacggcagtagtagatacggcagtggtagatacggcagtagtagttac
ggcagtagtagatacggtggaagtggtagttatgatgggagatcatcatctaatagatac
tcaggatattacacttcacctacatcaaaacaacaacaaccacaatccaataagggtaat
tattcatcacagacactgaatcaaaaacctaaaaactcttatgggaagagcaatggtcaa
cagtataaacaaccccaaccatatcagaattaccctcaaaatcaatataatcaagggtct
tctaacgacaattcaaaatataacaatggttctaaacagaattactccaattcaaactca
agatacagatacaagaatcaaacagtcaagaacaaaactattaatcaaaataccaatgtt
aatcaacaacaacaacaacaccgaggaagatttggccgatttggtggtggctttggtaga
atgatgagatggccgttgatgtttatgatgtttgatcggtttagaagaccaagacatgag
cctgtgcctatgcaacagccacaaccgcaacaccctccagttataaatgtatacaatcca
cctcacgatcaacaaactcgtgacaatgcgaatcaagaaactggcgatacaggctataat
tctcaagtacataatgaaactggtgcattcaacagaggaattgacgagccacatgatgac
aaacctttatctcgtgaagcagatttgacaccaagctctcccttggctccaccactcgat
gcaaataaaaatgattctcggttgattaaagatacaacaacaacaaccagggtgaaagtc
acacgaaccaaaagtgaaccgaatagattgcgagaattatcacatactccaacaattgaa
ccggtcagtagtaacgcatcaagtgctcgattgggtggtgaaggtggtggcggtggagac
aataatttggatattcatgaacttcgtgggtatcatactaatgaaatccccaatttacaa
acgagaacaagaagtagtaacaaagatttgctgagagggttatctaatcaaactattgga
ttacaaagtattcttcgacaatttccttcacaggaagtataa

DBGET integrated database retrieval system