KEGG   Candida orthopsilosis: CORT_0D04380Help
Entry
CORT_0D04380      CDS       T02488                                 

Definition
(RefSeq) Flc2 protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRP TRP_N
Motif
Other DBs
NCBI-GeneID: 14540378
NCBI-ProteinID: XP_003869413
UniProt: H8X630
Position
4:complement(849728..852157)
Genome map
AA seq 809 aa AA seqDB search
MLPYKLLLIGITCLFNVVSAVHYIKSSSLLTCMDNSQFTASYFDIVFYPGNRTIYFDINA
ISSIDAKVGAYINVIVYGLNVVQRNISLCDIDYESSGSGANPLCPLTSGHLNLDSHYQLG
SSISSQIPGIAYTVPDVDARVKVLIYDLESYDQLACVEATLSNGKTVQTKYAGWPIAAIS
GLGVVTSGVISVIGHSSTAAHIASNSMSLFIYFQSLAIMAMMAVARVPPIAAAWAQNFMW
SVGLIKIGFVQDISNWYIQATGGTPTDILGASYLSISVQRFAKRAMEWYEGMNSYDMAGL
SSSSGSPLAKRANILLDSDTFGTADNLDPDLYSTNEKATDLSGKILVLRGIQRVAYLASI
EITDVFMTGICFLFFFAFVMVVCLMLFKAIIEILTRSKAMHAEKFNEYRHHWGGIIKGSL
YRLLIIAFPQVSVLCIWELTARDSAGAVVVAVFLLVITLVLLIQAATRVFLMGRNSVRDF
KNPAYLLFGDVKFLNKFGFLYVQYRADCFWFIWVSLFYIFVKSLLVAVLQHHGKPQSVII
WVVELIHLVVVCWIRPFMDKRTNAFNITISVINFINALFFMFFSSVFGQPNVVSSVMAVV
YFVLNAVFALFLLIFTIVTCLLAIVRKNPDARYQPMRDDRVSFLPKSAGKKGAGTGGDDD
MELMALGATAMKGHEHGKRDPLAYDDESYDEDSVYQNTRNLSGPALGGEGTTSTGSGSND
YSPSKRDSISFMEPTQPGSTIVGNPYNALPTNYSNENNASTGSGFSFGQTGAYQGSSSSP
QNPYFQNTAYSNNQYYQQRNPSGSRTAFR
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgttaccatacaagctacttttaattggtataacctgcttgttcaatgtggtatcagct
gttcactacatcaaatcaagttcacttttaacttgtatggataattcacaatttacagca
tcatatttcgatattgtgttttatcccggaaacagaactatctattttgatatcaatgct
atttcatcaattgatgctaaagttggagcttatatcaatgttattgtttatggtttgaat
gtcgtgcaaagaaatatatctctttgtgatattgattatgaatcaagtggttcaggtgct
aacccactttgtccgttgacttcagggcatttgaatcttgattcgcattatcaattgggg
tcatcaattagtagtcagattcctggaatagcttatactgttcccgatgttgatgctaga
gttaaagtgttgatttatgatttggaatcttatgatcaattggcatgtgttgaagcaact
ttatccaatggtaaaactgtacaaactaaatatgccggatggcccattgctgcaatttct
ggtttgggtgttgtaacatctggtgttatttcagttattggtcattcaagcactgcagct
catattgcatcgaattcaatgtcacttttcatttatttccagtcattggcaatcatggct
atgatggcggtggctagagttcctcccattgctgcagcttgggcccaaaattttatgtgg
tctgtaggtcttatcaagattggatttgttcaagatatttccaattggtatattcaagct
actggagggaccccaactgatattttaggagcatcatatctttccatttcagtacaaaga
tttgctaaaagagctatggaatggtatgaaggtatgaatagctacgacatggctgggttg
tcatcgtcatcaggctccccattggccaagagagcaaacatcttgttagattcagatact
tttggtaccgctgacaatttagatccagatttatattctactaatgaaaaagccactgat
ttatcagggaaaattttggttttacgaggtattcaacgtgtggcctatttggctagtatt
gaaattactgatgtgttcatgacaggtatttgtttcttgtttttttttgcatttgttatg
gtggtttgtctcatgttgtttaaagcaattattgaaatcttgaccagaagtaaagccatg
catgctgaaaaatttaatgagtaccgtcatcattggggtggtattataaaaggatcactt
tatcgtttattgattattgcgtttcctcaagtttcagtattgtgtatttgggaattgaca
gctagagattctgctggagctgttgttgttgccgtattcttattggtcatcacattagta
ttattgatacaagcagcaacaagagtgtttctaatgggaagaaactcggtacgagatttc
aaaaatccagcttacttattatttggagatgtcaagtttttaaataaatttggattttta
tacgtccaatatagagctgattgtttttggtttatttgggtttcattgttttacattttt
gttaaatcgttgttggtggcagtattacaacatcatggtaaaccacaatcagtgatcatt
tgggttgttgaattgattcatttggtggttgtttgctggattcgtccatttatggataaa
agaaccaatgcattcaatatcaccattagtgttatcaacttcatcaatgcattattcttt
atgttcttttccagtgtttttggacaaccaaatgttgtttcttcagtcatggctgtagtt
tactttgtgctcaatgcagtatttgccttatttttgttgatattcaccattgtcacttgt
ttgttggctattgttagaaagaatccagatgccagataccaaccaatgcgtgacgatcgt
gtttctttcttgcctaaatcagccggtaaaaagggagctggtactggtggtgacgatgat
atggaattgatggctttgggagctacagcaatgaaaggacatgagcatggtaaacgtgat
ccattagcttatgatgatgaatcatatgatgaagattcagtatatcaaaacacaagaaac
ttaagtggtcctgcattaggaggagaaggaactacaagcactggatcaggatcaaatgat
tatagtccatcaaaacgagattcaataagttttatggaaccaacacaaccaggttcaacc
atagttggcaacccttataacgcgttacctacaaattactccaatgaaaataatgctagc
actggaagcggatttagttttggacaaactggagcttatcaaggtagttcatcaagtccc
caaaatccatatttccaaaacaccgcttacagtaacaatcaatattatcagcaaaggaat
ccaagcggaagtcgaacagccttcaggtga

DBGET integrated database retrieval system