KEGG   Candida orthopsilosis: CORT_0D04400Help
Entry
CORT_0D04400      CDS       T02488                                 

Definition
(RefSeq) phosphatidylinositol-4-kinase
  KO
K00888  phosphatidylinositol 4-kinase A [EC:2.7.1.67]
Organism
cot  Candida orthopsilosis
Pathway
cot00562  Inositol phosphate metabolism
cot01100  Metabolic pathways
cot04011  MAPK signaling pathway - yeast
cot04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CORT_0D04400
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    CORT_0D04400
   04070 Phosphatidylinositol signaling system
    CORT_0D04400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cot04131]
    CORT_0D04400
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     CORT_0D04400
Membrane trafficking [BR:cot04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    CORT_0D04400
 Endosome - Golgi transport
   Others
    CORT_0D04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka
Motif
Other DBs
NCBI-GeneID: 14540380
NCBI-ProteinID: XP_003869415
UniProt: H8X632
Position
4:856096..861843
Genome map
AA seq 1915 aa AA seqDB search
MDFYGITRGTIRGEALKKLAELTVEHVPSNLKEINTGIQKDDFAKLLTSTPKDLPLRKSI
GSINDQKMSNVAIAPKEYETLVALCDATDKPIKLTSQVKTLIDKFKVYLFELPDQQFAYS
IVAKSVAIAPWTLLGEKLTIALINLAYQANKHYFDEVVEIFHQFIEKFFDNVELHLSNFL
TLTGVIDGLNQNAQFLTYSSRTFRIFTNLDSAIDNSEILGAIEDYSDYLYDDPNPYQELL
ERDFCLNFSPILYLEKLSRLMCSILLEIVSSKSQSLLPYLLAQAAKKYDEDESNGGAIGH
GKDQLSFPRAQMEIIKILSDLALRKLEFLDRGETYIVYSTNNRLKLGYLAKSFNLQVLSC
GTFTDNLDLITSKELFKANIEIKDAMLDPDLGLTIFQFGSLLVFKDESIGPLLTRVFTSV
IANPRLEQQYCLEASKCVGLGSKRLPQDAVVTTIYSLTNLLFVTNEGLQGPSKSARRAAR
NYTGGTDNASSREFVSSPLSSRRTSMTSFSQLFSKGSISGEYDENDYQKVCENAVTAIIE
VSEACDDESIPALACTILSQKVTKVESPIGSLILKGLCSCAPYVPEREFIILIRLLNKLT
VDSFERKNVTLLGHLNDSRLILSSKLKPDNHLYFVYLHELLQSIISKGDVQQLEHHRSHN
EISEVGDQIAIYLKPLAELLPDVHLGQEPLKIEKTETINLFRNVWFNMVVHGYTLNSKNT
KVFKNELERIAYNSPPLISERSWDRTETSIELNTVLRRGSSNHNIKDHKTFLGDIFEIHR
TMSYPKLMFLSAAVLCESLRVRTGDCSKILYYFTDPTSKISGVDKYLGPISFKIVRDYIG
LINTGANKQFTADHIANQLTTMLTLSTHPVTEMQDASIQCCDLLINKVSASLCHKKSLFA
LFDILTLLFQSIADADIHEYDPTTSFRARCTGIKITMSDDYDWRCSTFNRFHEKAKSWVE
LLLYKSNIDVKSLIQSYVAANEELQYEAPIQFGLSFALKMSGTISSHDRDLQAITYANIS
ALDTTPSIVSQLNWRSNFVSQVMNKLPLRTDEESDFAFKAIREKVYNIKSRLFDQFNENP
SDDEIMSLLTEIAGLTLLSDSNNAELVRYMVEIPFLLFEPSVMIPASGVWFAVMKDKPKL
SMLLLSELAQKWEESIELRKGLFSQEFDIVHPEFDKMEYAPSNRSIDLKLADKAQRSFEP
HLELVRLFSSNFEATLNQSDHLLKLFTRFVEVGLKNLKFASYHPLSRLVRFELIKFSFEV
LQVHLKLGSRICKYLTELIFDGALTWFRQRFIYPFGANKLKFKSEAIVMNEVARMAGAVS
IFRSKDIEMKRTIFLQFLDDEVYKFNVWSTSLNPTDTSGSIIGSSHQVSSSHVTRAYEID
PILAINLAMRYQSKSHDDLIQQLIIKNPLPAVTYPDAVQFFIGINLGTHMPSHQLLFWSP
VSPIDAITLFLPPFGANPYILQYTMRSLETHDVNLTFFYVPQIVQSLRHDAKGYVERFII
ETAKVSQLFAHQIIWNMLANSYKDDDSTEPDDLKPVLDRIQEEMLKELSNEDLQFYHKEF
GFFNEVTDISGKLKPYIKKSKAEKKAKIDEEMALIKVEPGVYLPSNPDGVLVDINRKSGK
PLQSHAKAPFMATFKIKKELTDYDEHGKPQQVEIEKWQSAIFKVGDDCRQDVLALQLISI
FRTIWSDAGLDLYVYPYRVTATAPGCGVIDVLPNATSRDMLGREAVNGLFEYYITKFGPQ
KSIEFQRARNNLVKSLAAYSIISYLLQFKDRHNGNIMYDDQGHILHIDFGFCFDIVPGGV
KFEAAPFKLTHEMVMVLGGSDDTQAFKWFEELCIKGYLACRPYMELIVRTVVPMLESGLP
CFKDTTIKNLRSRFVPGKTDKEAAAYFRKLIKKSMESFYTRGYDEFQRITNGIPY
NT seq 5748 nt NT seq  +upstreamnt  +downstreamnt
atggatttctatggtatcactcgtggtacaattcgtggtgaagccctcaagaagttagct
gaactcacggttgaacacgttccgtccaatttgaaagagataaacactggtattcaaaaa
gatgatttcgctaaattattaacatcaactcccaaagatttaccattacgcaaatccatt
ggtagtattaatgatcaaaagatgtccaatgttgctattgcacctaaagaatatgaaact
cttgttgccttatgtgatgctactgataaaccaattaaattgacaagtcaagtcaagacc
ttgatcgataagttcaaagtatatttgtttgagttacctgaccaacaatttgcttatagt
atcgtcgccaaatctgttgctattgctccttggactttacttggtgaaaaattgacaatt
gcattgatcaatttggcttatcaagcaaacaaacattattttgatgaagttgttgaaatt
ttccaccagtttattgaaaaattttttgataatgttgaattacacttatccaatttcttg
acattgacaggtgtcattgatggattaaaccaaaatgctcagtttttgacatattcatca
aggacttttcgtattttcaccaatttggattctgctatcgataactctgaaattttgggt
gctattgaagattattcagattatctctatgatgatccaaacccatatcaagaattgttg
gaacgtgatttctgtcttaatttttcacccatactttatcttgaaaaattatcaagattg
atgtgttcgatacttttggaaattgtcagctccaaatcacaatctttgttgccttatttg
ttggcccaagctgcaaagaaatatgatgaagatgaatccaatggtggagccattggtcat
ggtaaagatcaattgtcctttccaagagctcaaatggaaatcataaaaattttaagtgat
ttggcattaaggaagttggagtttttggatagaggtgaaacttatatcgtgtactctacc
aataaccgtttgaaattgggatatttagctaaaagtttcaacttgcaagttttgagttgt
ggaacgtttactgataatttagaccttattacttcgaaagaattgtttaaagccaatatt
gagatcaaagatgccatgttagatcctgacttggggttgactattttccaatttggatcg
ttgttagttttcaaagatgaactgattggtcctttattaacaagagtgttcacttcagtt
atcgctaatccaagattagaacaacagtattgtttggaagcctcaaaatgtgtcggattg
ggaagtaagagattaccccaggatgcagttgtcaccacaatctattcgttaacgaatttg
ttatttgtcactaatgaagggttacaaggaccatctaagagtgccagaagagccgccaga
aactatactggtggtactgataatgcgtcatccagggagtttgtttcctcaccattgtct
tcaagaagaacttcaatgacatctttttcacaattgttcagtaagggtagcatatctgga
gaatatgatgaaaatgattaccaaaaagtgtgtgaaaatgccgtcaccgccattattgaa
gtttcagaagcatgtgatgatgaatcgattcctgcattggcatgtactatcttgtcacaa
aaagtgaccaaggttgaatcaccgattggatctttaattctaaaaggtttgtgttcatgt
gctccttatgttcctgaacgtgaatttatcattttgattagattattgaataagttaact
gttgattcatttgaaaggaaaaatgtgaccttgttaggccatttgaatgattcgagattg
attttgtcatcaaaattgaaaccagataatcatttgtattttgtctatttgcatgaattg
ttgcaatcgataatcagtaaaggcgatgttcaacaattggaacatcatagatcccacaat
gaaatcagtgaagttggtgatcaaattgcaatttatttgaaaccattggctgaattgtta
cctgatgttcatttaggtcaagaacctttgaaaattgaaaagaccgaaaccatcaattta
ttcagaaacgtgtggtttaatatggtcgttcatggttacactttaaattccaaaaatacc
aaggtttttaagaatgaattggaaagaattgcctacaactcgccacccttgatttcggaa
agatcatgggatagaactgaaacttcgatcgagttaaacactgtattgagacgtggttca
tcaaatcataatattaaagaccacaaaaccttcttgggtgatatttttgaaattcatcgt
acaatgtcatatcccaaattgatgtttttgtcagctgctgttctttgtgaaagtttgcgt
gttcgtactggtgattgttccaagattttgtattacttcaccgatccaacaagtaaaatc
tcaggtgttgataaatatttgggtccaatttcctttaaaattgttcgtgattatattggt
ttgattaatactggggctaataagcaattcactgctgatcatattgctaaccaattgaca
actatgttgacattatcaacccatccggttactgaaatgcaagatgcgtctattcaatgt
tgtgacttattgattaataaagtgtcagcatcattgtgccataaaaaatccttgtttgct
ttatttgacattttgacattgttatttcaaagtattgccgatgctgatattcatgaatat
gatccaactacttccttcagagcaagatgtactggaatcaaaattactatgtctgatgat
tacgattggagatgttctacattcaatcgattccatgaaaaagccaagagttgggttgaa
ttgttattatacaagagtaacattgatgtgaagagtttgattcaatcgtatgttgctgcc
aatgaagaattgcaatatgaagctccaattcaatttggtctttcatttgcgttgaagatg
tcgggaactatttcatcgcatgatcgtgatttacaagcaattacttatgccaacatatct
gctttagatactacaccttcaattgtatcacaattgaattggaggtcaaactttgtttct
caagttatgaataaattaccattgagaactgatgaggaatctgatttcgcatttaaagct
attagggagaaggtttataatatcaagctgagattatttgatcaattcaatgaaaaccca
tctgatgatgagattatgagtttgttgacggaaattgcaggactaactttgttatctgat
agcaacaatgctgaattggttagatatatggttgaaataccattcttattgtttgaacca
ctggtgatgattccagctagtggcgtttggtttgctgttatgaaggataagccgaagttg
agtatgttgttgcttagtgagttggcacagaaatgggaagaatcaatcgagttaaggaaa
ggcttattttcacaagaattcgacattgtccatcccgaatttgataaaatggaatacgca
ccaagtaatcgttcaatcgatttgaaattggccgacaaggcacaaagaagttttgaacct
catttagaattggttcgattgttttctagtaatttcgaagctacgttgaatcaaagtgat
catttattgaagttgtttactcgattcgttgaggttggattgaaaaacttgaaatttgct
agttatcatccactttcgaggttggttagatttgaattgattaaattttcatttgaggtg
ttgcaggttcatttgaagttaggatcaagaatttgtaaatatttgacggagttgattttt
gatggagccttgacttggtttagacaaagatttatttacccatttggtgccaataagttg
aaattcaagagtgaagcaattgtaatgaatgaagttgcaagaatggctggtgcggtatca
attttccgtctgaaggatattgaaatgaagcgtacaatatttttgcaatttctcgatgat
gaagtgtataagtttaatgtttggctgacttctttgaatccaactgatacttcaggttca
attattggttcatctcatcaagtatcaagtagccacgttactcgtgcttatgaaattgat
ccaattttggcaatcaatttggccatgaggtaccaaagcaagagtcatgatgatttgatt
caacagttgattatcaagaacccacttccagcagttacatatcctgatgctgtgcagttc
tttatcggtatcaatcttggtactcatatgccttcgcatcaattgttgttttggtcgcca
gtatctccaatcgacgccattacattgtttttacctccatttggtgccaacccttatatt
ttgcaatacactatgaggtcgttggaaacgcatgatgttaatttgacattcttttatgtc
ccacaaattgtccaatcattacgtcatgatgcaaaggggtatgttgaacgttttatcatt
gaaactgccaaagtatcacaattgtttgcccatcaaattatctggaatatgttggcaaat
agctacaaggatgatgattctactgaaccagatgacttgaagcccgtcttggaccgaatt
caagaagaaatgttgaaagaattgagtaatgaagatttacaattttatcacaaagaattt
ggatttttcaatgaagtcactgatatttcgggtaaattgaaaccatacattaagaaatct
aaagcagaaaagaaagccaagattgatgaagaaatggcattgattaaagtagaacctggg
gtgtacttgccatcaaatccagacggtgttcttgttgatattaatcgtaaatcgggtaaa
ccattacaatctcatgccaaagctccattcatggctacttttaagatcaagaaggaattg
actgattatgacgaacacggtaaaccacaacaggttgaaattgaaaaatggcaaagtgct
attttcaaagttggtgatgattgtcgtcaggatgtgttggccttgcaattgatttctatt
ttcagaactatttggagtgatgccggtttggatctttatgtgtatccttatagagttacg
gcaactgctccaggatgtggtgtgattgatgtattgccaaatgctacctcaagagatatg
ttgggtagagaagccgttaatggattatttgaatactatatcaccaagtttggaccacaa
aaatccattgaattccaacgagcaagaaacaacttggttaaatcattggcggcatattca
atcatttcgtatttgttacaattcaaagatagacacaatggtaatatcatgtatgatgac
caagggcatattttacatattgatttcggtttctgttttgatattgttccaggaggagtt
aagtttgaagcagcaccattcaaattgactcatgaaatggtcatggtattaggtggaagc
gatgatacgcaagctttcaaatggtttgaagaattatgtatcaaggggtatttggcatgt
cgtccgtatatggaattaattgtgagaactgtggtaccaatgttggaatctggattaccc
tgttttaaagacaccacgattaagaatttacgcctgaggtttgttcctggtaaaactgat
aaagaggcagcagcatattttaggaaattgattaagaagtcaatggagagtttctatact
agaggatatgatgagtttcaaaggattaccaacggtattccatactag

DBGET integrated database retrieval system