KEGG   Candida orthopsilosis: CORT_0D04410Help
Entry
CORT_0D04410      CDS       T02488                                 

Definition
(RefSeq) phosphatidylinositol-4-kinase
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 14540381
NCBI-ProteinID: XP_003869416
UniProt: H8X633
Position
4:862339..862896
Genome map
AA seq 185 aa AA seqDB search
MLGSDHFEETILESDFENMNIGELHIIYEKRNKTRTDIYKAKVKAFFEDFIKGLGPKFQE
SFSKIANVSQIVNMAKRPHKSYPESGLLPILDEASLSIHSYCSNIDSKRTLINRNPITIS
LLFFPQECQLAEEKCSTSKMSKKMQNKTIWTTRFNLTLLFDIFISGLRESNLVLFQFGTR
TCFDN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttaggctcggaccatttcgaagaaactattttggaatcagactttgagaatatgaat
ataggagagctacacatcatttacgaaaagagaaacaaaactcgtactgatatatacaaa
gcaaaagtaaaagccttctttgaagattttattaaaggtcttggtccaaaattccaagaa
ctgttttctaaaattgcaaatgtaagccaaattgtgaatatggcaaaacggccacataaa
tcatatccagaatcgggtttattgccgatattggatgaggcgagtttgagcatccacagt
tattgctcaaacattgatctgaaacggacattaatcaacaggaaccccataactatcagc
ttgttattttttccccaggaatgtcaattagccgaggaaaagtgttccacatcaaaaatg
tcaaaaaagatgcaaaacaaaaccatctggaccactagatttaatctaacattattattt
gacattttcatttctggcttaagagaatcaaatttagttttgttccagtttggaacaaga
acttgttttgataactag

DBGET integrated database retrieval system