KEGG   Candida orthopsilosis: CORT_0D04430Help
Entry
CORT_0D04430      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 14540383
NCBI-ProteinID: XP_003869418
UniProt: H8X635
Position
4:866657..867523
Genome map
AA seq 288 aa AA seqDB search
MFCYALLLYLVSLSHCNLQDQFPEIQWTDLDATTTITTQPITNNLTTSLLYKTNPQPHIY
TISTLEALQSSAHITKLSNTNNLFYIKSTQSSLQYDYQLNYWTLLTTTNTSSGSNFNFDA
NTDSISNSSSPSPPTQPHSWIPITSCLESIHGSGGYLSRYITIYLETTMDQIGEVTLGIP
PVYFSIGTSLAVGKRVGLSKLNTLLFSCSINPGEVAQFYIRPSFIEIPNLKCRWYKLKGK
KLHYVGFNVIKSFKMLVVDTPEHQCWVSRNINDLQCGKTFEDKVTIHL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttttgctatgcacttttactatatctcgtttctctatcccactgcaatctccaggac
caatttccagaaattcaatggacagacttagatgcaacaacaaccataacaacccaacca
atcactaataatctaactacatccctcttatacaagaccaacccacaaccacatatttac
acaatatcaacgctagaagcactacaatcctcagcccacattacaaaactatcaaatacc
aacaacttattctatatcaaatcaactcagagttcactacagtacgattaccaactcaac
tactggaccttactcaccacaaccaacaccagctccggctccaacttcaacttcgacgcc
aacacagactctatttcaaactcatcttccccatctccaccaacacaaccacattcatgg
atccccatcacatcatgcctcgaactgatacacggtagcggcggctacttaagccgatac
ataacaatctacctcgaaacaaccatggatcaaattggcgaagtgacactaggtatccca
ccagtgtacttctccattggtactagtctagccgtggggaaaagagttggtttatcaaag
ttaaacacgctattattcagttgttcaataaatcctggtgaagtagctcaattttatata
cgacctagttttattgagattcctaatttgaaatgtcgttggtacaaattgaaggggaaa
aaattgcattatgttggatttaatgttatcaaactgtttaaaatgcttgttgttgatact
cctgaacatcaatgttgggtatcgagaaatattaatgatctacaatgtggaaaaactttt
gaagataaggttacaattcatctatag

DBGET integrated database retrieval system