KEGG   Candida orthopsilosis: CORT_0D04450Help
Entry
CORT_0D04450      CDS       T02488                                 

Definition
(RefSeq) Kgd2 dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cot  Candida orthopsilosis
Pathway
cot00020  Citrate cycle (TCA cycle)
cot00310  Lysine degradation
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cot_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CORT_0D04450
  09105 Amino acid metabolism
   00310 Lysine degradation
    CORT_0D04450
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CORT_0D04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N YL1 Presenilin
Motif
Other DBs
NCBI-GeneID: 14540385
NCBI-ProteinID: XP_003869420
UniProt: H8X637
Position
4:873451..874827
Genome map
AA seq 458 aa AA seqDB search
MLSRGVNSSLKRTAQRALKSNVATTSLKFSSVQATRSLHNQPITKTHHNTINNKFASLSL
GSVRYASTKVKVPDMAESITEGTLAAFNKEVGDFVNLDETIATIETDKIDVEVNAPVSGT
ITKFLVDVESTVEVGQEIAEIEEGDAPEGGASAKKEESSSGKDEGEQQKEEPKKEEPKKE
ESKPEPKKEEPKKESKPAPPKKESSSPKKQETSSSSDAPTFTNFSRSEERVKMNRMRLRI
AERLKESQNTAASLTTFNEVDMSNLMEMRKLYKDEFLEKTGIKLGFMGAFSKAACLAAKD
IPAVNASIENNDTLVFRDYTDISIAVATPKGLVTPIVRNAESRSILGIEKEIAALGKKAR
DGKLALEDMVGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHGVKQRPVTVNGQIVSRPM
MYLALTYDHRVLDGREAVTFLKTIKELIEDPRKMLLLE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagaggagttaattcaagtttaaaaagaactgctcaaagagcactcaagtca
aatgttgccaccactagtttgaaattttccagcgttcaagctactagatctcttcataat
caaccgattaccaaaactcaccacaacaccatcaacaataaattcgcttccttgtcttta
ggttctgttagatatgcgtctaccaaagtcaaagtaccagatatggctgaatcaatcact
gaaggtactttagctgctttcaataaagaagttggagattttgtaaatttagatgaaact
atcgctactattgaaactgataagattgatgttgaagtcaatgctccagttagtggtact
atcaccaaatttttagttgatgttgaatcaactgttgaagttggacaagaaattgctgaa
attgaagaaggcgatgctccagaaggtggtgcttcagccaagaaggaagaatcatcatcg
ggtaaggatgaaggagaacaacaaaaggaagagccaaagaaagaggaaccaaagaaggaa
gaatccaaaccagaacctaaaaaagaagaaccaaagaaagaatctaaaccagcccctcca
aagaaggaatcatcatcaccaaagaaacaagaaacttcctcttcttcagatgctccaact
tttaccaacttttctagaagtgaagaaagagtcaagatgaacagaatgagattaagaatt
gctgaacgtcttaaggaatcacaaaacactgctgcttcattaactacattcaatgaagtt
gacatgtccaatttaatggaaatgagaaaattatacaaggatgaatttttggaaaaaact
ggaatcaaattaggtttcatgggtgcattctccaaggctgcttgtttggctgctaaagac
atcccagctgtcaatgcctccattgaaaacaatgacaccttagttttcagagattatact
gatatttcaattgctgttgctacaccaaagggtttagtcactccaattgttcgtaatgcc
gaatcaagatcaattttgggtattgaaaaagaaattgctgccttgggtaaaaaagccaga
gatggtaaattagccttggaagatatggttggtggtacattcaccatttctaatggaggt
gtctttggatccctttatggtactccaattattaatatgccacaaactgccgtattagga
ttacatggtgtcaaacaaagaccagtcactgttaacggacaaatcgtttctagaccaatg
atgtatttggccttgacttatgatcatagagttttggatggtagagaagctgttacattt
ttaaagactattaaagaattgattgaagatccaaggaaaatgttacttttggaataa

DBGET integrated database retrieval system