KEGG   Candida orthopsilosis: CORT_0D04480Help
Entry
CORT_0D04480      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kelch_3 TMEM154 DUF4448 Orf78 DUF5074 DUF5385 Kelch_6
Motif
Other DBs
NCBI-GeneID: 14540388
NCBI-ProteinID: XP_003869423
UniProt: H8X640
Position
4:complement(882471..884477)
Genome map
AA seq 668 aa AA seqDB search
MSRLNKNWNSLYSYNQGTVYLHLKNNDLLQLRFDLNGSFTDESNLQNNQQVTALTPPPNN
STLFILNDELYGLKKSESSQDSDICGDGSFSIVKFDDDSWDNEIELDFNKVADSSFYQYS
TVLTNSDTSDLLYIYGGLCGQTNESTNRLVSVNVSSGQVNNITTSTKPQPFYGASNILAP
NVQSQLIIGGESNSGWLNMYQLATWDFSSGWSFRQVNKVDDTTINSRTFPLTLPLFKPLT
ASDNVSNNFRIDEVLMIGGDLGSEESTPKYAKLQMNSNDWTWNATEAEGFQLGEVLGAAT
LFSTLVIINSTRDLKDKRMVSQGYQVNLYDVDTFEPVSNVKENTKLLETTSDSRPSNSSN
NKEKIILGTVLPIFFVSLITGILVFFYIYKRKKSKSPEENSAYNEIDYKFDYVDPPASFT
AGNHHHLSPLYLHDNDSNSTLSGAASIDSWMKKRQDFDRSRLRNSYLASNETLQTVDDEV
SSRASEEHQRDEEMLEVKNVRPSLDPNNPFVHKSVRNLRKSFSFSQTPPTSPVMKNEQVK
LKSKRLTKTEHLMGNALIDDEGAEDDKLVKGVLIPHHESNSELTSIDDKMDVQVLVSSKR
RSILKIMNPDTANGDDETGITHYESSSQIDNEGDATHNEEADRSQGDVEHVNDEYTNLRQ
RIPSGSKE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacttaataagaactggaacagtttgtactcttacaaccaaggtactgtctac
ctacatttgaaaaacaatgacttgctccaactacggttcgacttgaatggactgtttact
gatgaaagcaatttacaaaataatcaacaagtgacagcattgacaccaccaccaaacaat
tcgacgttgtttattttaaatgacgaattatatgggttaaagaaaagcgaatcgagtcaa
gacagtgatatatgtggcgatggaagtttttctattgtaaagtttgacgacgattcatgg
gacaatgaaattgagttggactttaacaaagtagctgactcatcgttttatcaatattcg
actgtcttaactaatagcgatacttcagacttgttatacatctatggtggattatgtgga
caaactaatgaatcgacaaacagattggtgtcggtcaatgtatcatcgggccaagtcaat
aatattaccacatcaactaaaccacaaccgttttatggagcctccaatattcttgcacca
aatgttcaatcacaactaataattggtggtgaactgaatagcgggtggttaaatatgtac
cagctagcgacatgggattttagttccggctggtcattcaggcaagttaacaaggttgat
gatactacgatcaactcaagaactttccctttaacccttccactattcaagccactcaca
gcttccgacaatgtttctaacaactttcgcattgatgaagtgttgatgattggtggtgat
cttggcagtgaggaaagcacaccaaaatatgccaaattgcaaatgaatagtaatgactgg
acctggaatgcaacggaagcggaagggtttcaactaggtgaagtattgggtgctgcaact
ttattttcgacattggtgattatcaactccacgagagatttaaaggataagcgtatggtt
agtcaaggataccaggtcaatctatacgatgttgatacttttgaaccagtgagtaatgta
aaggaaaataccaagctactagaaactacaagtgattcccgcccaagtaatagctccaac
aataaagaaaagattatcttaggaacagtactaccgattttttttgtgtcattgattacg
gggattcttgtatttttttatatatacaagcgcaagaaatcaaaatcaccagaagaaaac
tcggcttataatgaaattgattacaagtttgactacgttgacccaccagcttcgtttacg
gctggtaaccatcatcacctatcaccactatatctacatgataatgactcaaattcaaca
ttgagtggtgctgcatcaattgattcttggatgaaaaagagacaagattttgatagaagt
cgattgaggaatagttatcttgcttcaaatgaaacattacagactgttgatgatgaagta
agtagtcgtgctagtgaagaacatcaacgagacgaagagatgttagaagtgaaaaatgta
cggcctagtttggatccaaataacccatttgtgcataaatctgtgcgtaatttacgcaaa
tcattcagtttttctcaaactccaccaactagccctgtaatgaagaatgaacaagttaag
ctcaagagtaagcgattgaccaagacggagcatttaatgggaaatgcattgattgatgat
gaaggtgcagaagacgataaactcgtcaaaggtgttttaataccacaccatgaatcaaac
tctgaacttacgtcaattgatgataagatggacgtgcaggtgttagtcagtagtaaaaga
agatcaattttgaaaattatgaatccagatactgctaatggtgatgatgaaacgggtatt
actcactatgagctgctgctgcaaatcgataatgaaggagacgctacccataatgaagaa
gcagatcggagccagggcgacgtggagcacgtgaacgacgaatatacaaatcttagacag
agaataccatctggctcgaaggagtaa

DBGET integrated database retrieval system