KEGG   Candida orthopsilosis: CORT_0D04560Help
Entry
CORT_0D04560      CDS       T02488                                 

Definition
(RefSeq) 3-hydroxyanthranilic acid dioxygenase
  KO
K00452  3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
Organism
cot  Candida orthopsilosis
Pathway
cot00380  Tryptophan metabolism
cot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    CORT_0D04560
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.6  3-hydroxyanthranilate 3,4-dioxygenase
     CORT_0D04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3-HAO Cupin_2 Cupin_1 AraC_binding ARD YhfH RecR
Motif
Other DBs
NCBI-GeneID: 14540396
NCBI-ProteinID: XP_003869431
UniProt: H8X648
Position
4:897542..898051
Genome map
AA seq 169 aa AA seqDB search
MLPPPINIHKWVEENEDKLRPPVNNFCLHRGGFTVMIVGGPNERSDYHINQTPEYFYQYK
GTMCLKVVDDGKFRDIFINEGDSFLLPPNIPHNPCRYKDTIGIVVEQDRPEGVNDAIRWY
CSNCEDIVYHTDFYLTDLGTQIKEAIIAFDSNLDVKTCKNCGHINSSKR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgcctccaatcaacattcataaatgggtagaagaaaatgaggataagttgagg
ccaccagtgaacaatttttgtttacacagaggtggctttaccgtgatgatagttggtggt
cccaatgaaagaagcgattatcatattaatcaaactccggagtacttttatcaatacaaa
ggtactatgtgcttaaaagttgttgacgacggaaagtttagagatattttcatcaatgag
ggagactcttttttgttgccaccaaacattccccataatccatgtcgttacaaagacacg
ataggtatagttgttgaacaagatcgtccagagggtgttaatgatgcaattagatggtac
tgtagtaattgtgaagatatcgtttaccatacagatttctacttgactgatttgggaacg
caaattaaagaagctatcattgcatttgactcaaacttggatgtcaaaacttgcaaaaat
tgcgggcatataaactcgtccaaaagatag

DBGET integrated database retrieval system