KEGG   Candida orthopsilosis: CORT_0D04600Help
Entry
CORT_0D04600      CDS       T02488                                 

Definition
(RefSeq) Ste13 protein
  KO
K08787  dipeptidyl aminopeptidase Ste13 [EC:3.4.14.-]
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cot01002]
    CORT_0D04600
Enzymes [BR:cot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.-  
     CORT_0D04600
Peptidases [BR:cot01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   CORT_0D04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPPIV_N Peptidase_S9 Abhydrolase_6 Esterase pP_pnuc_2 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 14540400
NCBI-ProteinID: XP_003869435
UniProt: H8X652
Position
4:902594..905365
Genome map
AA seq 923 aa AA seqDB search
MYSKLNSDERIEQYEMVDQSHRRSTSGNEEDALGEELPSKSSTDSRSSDFLDDIENCALR
TGETKDDFNSDPFYQSILRKYRKQGFPLKYCSIVGMVCLILWIGGIVAYSHQSPSQLISN
TKWQTNVHLGGLNVTLAKYDPRSKNLTFDGWRNGDYLTYEEEVHWLNEKQSPQDKRGGYY
LTSTSHSFLIRQANSEYEAVFLPSKKFAYQNNFFNIEEVALNPTNPIDQLNNIHLIKTDT
LKQWRHSSFALYWLYNPQLSMYTPIQPPVKSSGQKSTSKLSGSRLEKLHFAEFSPDGKFV
LFAFEHNIYIQNVSDNKAQQITTDGSRHIFNGKPDWVYEEEVVATDRMVWWSPDSKHFVF
TKINDTQIKDVDIDYYVKINTEVGMQYDQSSDKRYQQVDQYPIKSSLLYPKPGTQNPIPS
FYVYHMDERKLEALQDKDDSLGRDFVVYQASWIDENNFLVKETDRTSEMLSKKLFTSSAT
SLRLLGSVNVTKLYGGWVGKMKPITVIDGSYVDNYVVDGKNYLALFNKPDDVTPSKILNK
FQAISEAFYDRAENFLYFLTNEKSAMDSHLVGYDLSRDKYVEITSLGEDGYYIASFSRNG
RFLNLQYEGPNQPWQRLIDMAELHDSLEDAATLEKAILQHPMVNHFDVSKKHFQNFNFPT
VIHRQIKISKYDIALSVEEILPPNFNPAQKYPLLVHAYGGPGSQNVLKKFDIDFLKVASA
ELNAVVLVIDPRGTGGNDWRFQAFANDRIGYWEPRDIKLITSEYMSANDFIIKGSVALWG
WSYGGFTTLKTLEYDNGRVFKYGVAIAPVTNWLFYNSIYTERYMNQPSKNPNYEKYARVR
IVENFKNINRFLLMHGSADDNVHLQNTMWFINQLNSANVKNYDMQIFPDSNHNIDYHNAN
TLVYGKLLSWLQNAFSGRFDNML
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtactcaaaactcaattcagatgaacgtatagaacaatatgaaatggtggatcaaagt
catcgacgatccacctctggcaacgaagaagatgctttaggagaagagctcccttctaag
ctgtccaccgattctcgatcatcagactttttagatgacattgaaaactgtgcattaaga
actggtgaaacaaaggacgattttaatagtgacccattctatcaatctattttacgaaag
tatcgaaaacagggctttcctttaaagtattgcagtattgttggaatggtgtgtttgatc
ttatggataggtggtattgtggcctattctcatcaaagtccttcacaactaatatcgaac
accaaatggcaaacaaacgtgcatttgggtggcctaaacgttaccctagcaaagtacgat
ccacgcctgaagaatctcacgtttgatggttggaggaatggtgattatttgacctatgaa
gaagaagtacattggttaaatgagaaacaatcaccgcaagataaaagaggaggttattac
ttgacgtcaactctgcattcatttttgattaggcaggctaatagtgaatatgaggctgta
tttctaccgtcaaaaaaattcgcttatcagaataattttttcaatattgaagaagtggct
ttgaatcccacaaatcctattgatcaactcaacaatattcatcttatcaaaactgacact
ttgaaacaatggagacacctgtcatttgccttatattggctttacaatccccaactttca
atgtacacacctattcagccaccagtgaaaagcagtggccagaagagcacatcaaaattg
tccggttcacgcttggagaagttgcattttgctgaattctctcccgatggtaaatttgtc
ttgtttgcctttgagcataatatatatatccagaacgtatctgacaataaagcccagcaa
atcaccactgacgggtcacgacatatctttaatgggaagcctgattgggtttatgaagag
gaggtagttgcaactgatcgcatggtttggtggtcgcctgactcgaaacattttgtgttc
acaaagattaacgatactcaaatcaaggacgttgatattgattactatgtcaagataaat
actgaggtgggtatgcaatacgaccaatcaagtgataaaaggtatcaacaggtggatcaa
tacccaatcaaaagctcacttttataccccaaacccgggacacagaaccctataccttca
ttttatgtgtaccatatggatgagcgaaaacttgaagctttgcaggacaaagatgacagt
ttgggaagagattttgtggtgtatcaagctagctggattgatgaaaataattttttggta
aaggaaaccgatagaacaagtgaaatgctttcaaagaaattgtttacatcaagtgcaacc
agtttgcggttactaggttcagttaacgtgacgaagttatatggcggttgggtggggaaa
atgaagccaattacggtaatagatggttcatacgtggataactacgtcgtggatggtaaa
aattatctagcattattcaacaagccggatgatgtcacgccactgaagattttaaacaaa
ttccaagccattagtgaggcattctatgaccgagctgaaaattttctctactttctcacc
aacgagaaaagtgctatggactctcacttggtcggatatgatctttcaagggataaatat
gttgaaattactagcttgggagaggatggatactacatcgcttcattttcgcgaaatgga
agatttttgaacctccagtatgaaggaccaaaccaaccatggcaaagactaattgacatg
gctgaattgcatgactccttagaggatgcagccaccttagagaaggcaatcttacaacac
ccaatggttaatcattttgacgtatcaaagaagcattttcaaaacttcaactttccaacg
gtgattcataggcagattaaaatttcaaaatatgatatagcattatctgtagaggaaatt
ttgcctcctaatttcaacccagcacaaaaatatccacttttagttcacgcttatggtggt
ccaggttcacaaaatgtgttgaaaaaatttgacattgattttttaaaagtggctagtgca
gagttaaatgcagtggtgcttgtgattgatcctcgaggaacaggaggaaacgactggaga
tttcaagcatttgctaatgatagaattggttactgggagccaagagatatcaagttgatt
acttcagagtatatgctggcaaatgattttatcatcaaaggtctggttgcattatgggga
tggtcttacggcggcttcactacattgaaaactttggaatatgataatggccgagtattc
aagtatggagttgctattgccccagtcactaactggttgttttacaactctatatacaca
gaacggtatatgaaccaaccaagcaagaaccccaactatgaaaagtatgccagagtgcgg
attgtggaaaatttcaaaaacattaacagattcctccttatgcatggatcagccgatgac
aatgtacatttacagaataccatgtggtttattaaccaactcaattctgcaaacgttaaa
aattatgatatgcaaatattcccggatagtaatcacaatattgattaccataacgcaaat
acactcgtatatggtaaactattgtcatggttgcaaaacgcttttagcggaagatttgac
aatatgttatag

DBGET integrated database retrieval system