KEGG   Candida orthopsilosis: CORT_0D04710Help
Entry
CORT_0D04710      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_12 Ubie_methyltran Methyltransf_23 PCMT Methyltransf_9 MTS MetW DREV Methyltransf_32 Methyltransf_4 Methyltransf_29 CMAS CheR PrmA RrnaAD FtsJ
Motif
Other DBs
NCBI-GeneID: 14540411
NCBI-ProteinID: XP_003869446
UniProt: H8X663
Position
4:complement(926109..926948)
Genome map
AA seq 279 aa AA seqDB search
MTNDQVYYSKGFKKSVSDTHAWRTVDNSTKFITTVLKPDFKVLDVGCGPGSITVDLAKNY
LNENGSVVGVEPTQELIDTANEYKNTVAPSLNNVKFQAGSIYELPFDDNSFDLVFAHQVI
IHLQDPVKGLQELARVAKPDGYVAVKDADLESIIASPEKYQLLRDYFVEKAKNAISTDTK
AGRTLREKAIKAGYKSDQITTSKSYWLLADDINSKKQWVELTNNRIKNGGEVIYPNDERK
NEEISNQIISTWEEWLKDEASLFNISHFEIVYKKPIDSK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgatcaagtatattacagcaaaggttttaagaaatctgtgtctgatacacac
gcatggagaactgtggacaactccaccaaattcatcaccacagtacttaagcccgatttc
aaggtattggatgtcggctgtggtcccggcctgattacagttgatttagcaaaaaattac
cttaacgaaaatggttcggtagtgggggttgagccaacacaagagttgattgatactgca
aatgaatacaaaaacactgtggcaccctctttgaataatgtgaagtttcaagcaggatca
atttatgaattaccattcgatgacaatagttttgatttggtatttgctcaccaagtaatt
attcatttacaagatccagttaaaggtttgcaagagttagcaagagtcgccaaaccagat
gggtatgttgctgtaaaagatgccgatttggaatcgattattgcatctccggaaaagtac
caactacttcgagattactttgttgaaaaagccaaaaatgcgatctccactgataccaaa
gcaggtagaacattgagagagaaagccattaaagccggttacaagtcggatcagatcaca
acttcgaaatcttattggttgttagctgatgatatcaattctaaaaaacaatgggttgag
ttgacaaacaatagaatcaaaaacggaggagaagtcatctatcccaatgatgaaaggaaa
aatgaagagattagtaatcaaatcatttcaacatgggaagaatggctcaaggatgaagct
tctttattcaatatctcccactttgagattgtgtataagaaacctatagactctaaatag

DBGET integrated database retrieval system