KEGG   Candida orthopsilosis: CORT_0D04730Help
Entry
CORT_0D04730      CDS       T02488                                 

Definition
(RefSeq) Gst3 glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cot  Candida orthopsilosis
Pathway
cot00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CORT_0D04730
Enzymes [BR:cot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CORT_0D04730
Transporters [BR:cot02000]
 Other Transporters
  Pores ion channels [TC:1]
   CORT_0D04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_C GST_C_2 GST_N_2
Motif
Other DBs
NCBI-GeneID: 14540413
NCBI-ProteinID: XP_003869448
UniProt: H8X665
Position
4:complement(928254..928898)
Genome map
AA seq 214 aa AA seqDB search
MATLYTAETGNGRKPLILVKLLDAPIKVHLFDWPSKEIKSGSYLKLNPNGLVPTFVDDDI
GSIFESNAILEYIASKYDKEGKFSYKEQDDPKLYWHQKEWLYFQASQFAAHTLSRGVYYI
QMNPNDEFTKENVLHNFAKLYDVIEGQLIQNGSGWLIGDKFTIVDIAFATGNHRRIEVFT
GTDYEIKDFDEKYPKVVKWYENVLAIDGVKDVLT
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcaacattatacacggcggaaacaggtaatggtagaaaaccattgatcttagttaaa
ttacttgatgctcctatcaaagttcatcttttcgattggccatcgaaggaaatcaagagt
ggcctgtatttgaaattaaaccccaatggattagtcccaacttttgttgatgatgatatt
ggaagcatctttgaaagcaatgccatcttggaatacattgcttccaaatatgataaagag
ggtaaatttagttacaaagaacaagatgatcctaaattatattggcaccaaaaggaatgg
ttgtatttccaagcatctcaattcgcggctcataccttgtctagaggtgtttattatatc
caaatgaaccccaatgatgaattcaccaaggaaaatgtgttgcacaattttgctaaattg
tatgatgttattgaaggacaattgattcagaatgggtcaggttggttaattggagataaa
tttaccattgttgatattgcttttgccacgggtaatcatagacgtattgaagtgtttacg
ggaactgattacgaaattaaagattttgatgaaaaatatccaaaagttgtcaaatggtat
gagaatgttttggctattgatggggttaaagatgtacttacatga

DBGET integrated database retrieval system