KEGG   Candida orthopsilosis: CORT_0D04750Help
Entry
CORT_0D04750      CDS       T02488                                 

Definition
(RefSeq) Mtg2 protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 FeoB_N Arf ABC_tran Ras
Motif
Other DBs
NCBI-GeneID: 14540415
NCBI-ProteinID: XP_003869450
UniProt: H8X667
Position
4:complement(934203..935843)
Genome map
AA seq 546 aa AA seqDB search
MKQSSCIMLPRLMRRSLSTSSYLRNISSSTTSFAPNYAFHNSFPDTSGKEVFLKTIAEAD
DETQVVKVSQIIDHPTTTTTASISKLKSPKPRNIISIADYFSGNSHHLHHVFYSNLIHAK
TKKAAKVENKMFIDLRIMKLTSGAGGNGAVSFFRDNLTTSGPPDGGDGGSGGNIYINVVD
RNLNSLHYLQKRYVAKSGSPGKGGQLDGKNGDDVIIDIPLGTVIRWIPDPTIFKKHVSKK
EGDSLDDVYMELELDMNYGKDNIQLKRHAYKPGEGWIFKEHDEEYYQSRDFFQELNDKVT
KYDEEIEFEEQQQDQFPILGMDCDKVTKKPLLLLHGGKGGLGNMHFLTSNVRNPRFCKIG
RPGITAHFLLELKLIADLGLVGLPNAGKSSLLRAISRAKPRVGHWEFTTLQPTIGTIQHR
IDSDPFTVADIPGIIKGASENKGMGLDFLRHIERSGGLVFVVSLESNDPVEDLQILIDEV
GDKRMKDKKVLVVATKADLSNEGENYQTLRSFIEARHGSWKIVPVCAPKGENIDRCLELM
SEVARK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatcgtcatgtataatgttacctagactaatgcgtcggtcgctttccacgtca
tcatatctacgaaatatctcatcatcaactacttcatttgcacccaactatgcatttcac
aactcatttccagatacttctggtaaagaagtatttttaaagactatagccgaagcagat
gacgaaacacaagtggttaaagtatctcagattattgaccatccaacaactacaactaca
gcctcgatctcaaaactcaaatcaccaaaaccaagaaatattataagtatagctgattac
ttttcaggtaactcacatcatttgcatcatgtattctattcgaacctaatacatgcaaag
accaaaaaggcagccaaagttgagaacaaaatgtttattgatttaaggattatgaagttg
accagtggagctggaggtaatggagcagtttcatttttccgtgataatctaactacttct
ggtcctcctgatggtggtgacggtggaagcgggggaaacatctatatcaatgttgtcgat
cgtaatttgaattcactacattatttacaaaagagatatgttgccaaactgggttcacct
ggtaaaggaggacaattggatggtaagaatggagacgatgtaattattgatataccattg
ggtactgttattcgctggattcctgatccaacgatattcaagaagcacgtgtccaaaaag
gaaggagattcattagatgacgtgtatatggaacttgaattggatatgaattatggtaaa
gataatattcaattgaaacgtcatgcgtataaaccaggtgaaggatggattttcaaagag
catgatgaggagtattaccaactgcgagattttttccaagaattgaatgacaaagtgact
aagtatgatgaagaaatcgaattcgaagaacaacaacaagaccaattccctatacttggt
atggattgtgataaagtcacgaaaaagcctttgttgcttttgcatggaggtaaaggagga
ttgggaaatatgcatttcttaacttcaaatgtgcgtaatccacgattttgtaaaattggt
cggccgggaattacagctcatttccttcttgaactaaagcttatagcagacttaggactt
gttgggttaccaaatgctggtaagtcaagtttgctacgtgctatatcacgagccaaacct
agagttggacattgggaatttacaacattacaaccaactataggtacaatccaacatcga
attgactctgatccttttacagttgctgatattccagggataattaaaggtgcatcggag
aataaaggtatgggattagattttcttcgtcatattgaacgatcaggtgggttggtattt
gttgtttcgttagaatctaatgatccagttgaagatttacaaattttgattgatgaagtg
ggtgataaacgaatgaaggataagaaggtattggttgttgccacgaaggctgatttgagt
aatgaaggtgaaaattatcaaactttgagactgtttatagaggctagacacgggtcatgg
aagattgttcctgtttgtgcacctaaaggagaaaatattgatcgatgtttagagttgatg
agtgaagttgctcgcaagtga

DBGET integrated database retrieval system