KEGG   Candida orthopsilosis: CORT_0D04780Help
Entry
CORT_0D04780      CDS       T02488                                 

Definition
(RefSeq) Brf1 component of the general transcription factor for RNA polymerase III (TFIIIB)
  KO
K15196  transcription factor IIIB 90 kDa subunit
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cot03021]
    CORT_0D04780
Transcription machinery [BR:cot03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIB
     CORT_0D04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIB BRF1 TF_Zn_Ribbon Cyclin_N Ribosomal_S27e
Motif
Other DBs
NCBI-GeneID: 14540418
NCBI-ProteinID: XP_003869453
UniProt: H8X670
Position
4:938093..939751
Genome map
AA seq 552 aa AA seqDB search
MSVRVQKQQKCVNCGHTQFDVNRYTAAGDVSCLRCGTVLEENPIVSEVQFGESSSGAAMV
QGAMVGADQARATFAGGRQNAMESREQTITNGKRKIRRIAAALKIPDFIAEAAGEWFKLA
LTMNFVQGRRSNNVLATCLYVACRKEKTPHMLIDFSSRLQISVYSLGATFLKMVKALHIT
SLPLADPSLFIQHFVEKLDFKDKATKVARDATKLAQRMSADWIHEGRRPAGVAGACVLLA
ARMNNFRRSHSEIVAISHVGQETLQRRLNEFKKTKAAQLSVQRFRNDEEVESANPPSFEK
NRKNELRIARTLQRRQQETFNDLESMTEDEKIQYLGDLSKDEQQKQILMNTIMSDITINK
ELINEQIERILRSKRNKMEQSLYKTPHELAKEKVEEDDLDRIWNMNWPRNLVKNLPTTND
VLKLVSSETDLNSDDDDAVVEESQMTPEEVAMKERIWTGLNHDYMVEQERKRLKHEADEL
TGNTSANTGANRRKRQRSSVPPEIQKEIGDIILDEDGTPKSAGDSAKMYFSKTSVSRKIN
YESLQGLFGEKF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgagagtacaaaaacaacaaaaatgtgtcaactgtgggcatactcagtttgac
gtgaatagatacacagcagcaggcgatgtgtcatgtcttcgatgtggtactgtccttgaa
gagaatcctattgtttccgaagtccagtttggtgagtcatctagtggtgcagccatggtt
cagggtgctatggttggagctgatcaagcaagagcaacatttgctggtgggagacagaat
gcgatggaaagtagagaacaaacaataactaacggaaaacgaaagattagaagaatagca
gcagcattgaaaataccagattttattgctgaagctgcaggagagtggtttaaactagcg
ttgacgatgaattttgttcagggaagacgttcaaataatgttttagctacatgtctttat
gtagcgtgtcgtaaggaaaagacacctcatatgttgattgattttagttccagattacaa
atatcagtgtattctttaggtgctacatttttgaaaatggtcaaggcactacacataaca
tcattaccattagcagatccgtctttgtttatacaacattttgttgaaaagttggatttt
aaagataaagcgacaaaagttgctagggacgcaacaaaactagcgcaaagaatgtctgct
gattggattcatgaaggaaggcggccagctggtgttgcaggtgcttgcgttttgctagct
gctaggatgaataattttagaagaagtcattcggaaattgtggcaatttcccatgttgga
caagagaccttgcagagaagattgaatgagttcaaaaagactaaagccgcacaattatct
gtgcagagatttcgcaatgacgaggaggttgagagtgccaatcccccttcgtttgagaag
aatagaaagaatgagttgagaatagctcgtactttacaaaggcggcaacaagaaacattc
aatgacttggaaagtatgactgaggacgaaaagattcagtatcttggtgatctctctaaa
gacgaacaacaaaagcaaatactcatgaacacgataatgagtgacatcactataaataag
gagttgattaatgaacaaatcgagaggattttgagatcgaaacgtaacaaaatggaacag
tcgttatacaagaccccacacgagttggccaaggaaaaagtagaggaggatgatcttgat
agaatctggaacatgaattggccaagaaacttggtcaaaaacttaccaaccacaaatgat
gttctcaagctagtatcttctgagactgacttgaactcagatgatgatgacgcagtggta
gaggagagtcaaatgacacctgaagaagtggctatgaaggaacgtatctggacaggtctc
aaccatgactatatggtagaacaagaacgtaaaagattgaagcatgaggccgatgaatta
actgggaatacttctgcaaatactggggccaatcgccggaagagacaacggtcctcagtg
ccacctgagattcagaaagagattggtgatattattttggatgaagacggaactccaaag
agtgcaggtgatagtgcaaaaatgtatttctccaagacatcagtgtcaaggaagattaac
tatgaatctttacagggcttgtttggagaaaagttttga

DBGET integrated database retrieval system