KEGG   Candida orthopsilosis: CORT_0D04790Help
Entry
CORT_0D04790      CDS       T02488                                 

Definition
(RefSeq) Sda1 protein
  KO
K14856  protein SDA1
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cot03009]
    CORT_0D04790
Ribosome biogenesis [BR:cot03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    CORT_0D04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDA1 NUC130_3NT EF-hand_14
Motif
Other DBs
NCBI-GeneID: 14540419
NCBI-ProteinID: XP_003869454
UniProt: H8X671
Position
4:939909..942131
Genome map
AA seq 740 aa AA seqDB search
MGKQRRAAILPTNIILLQNVVRRDPESYHEEFLQQLSHYESLRDLYLENPTGADSNSTTE
FIELIGFLSAVCNCYPKETKNFPEELKTILLDNHRDLAPELREKIIQCLTMLRNKDIITA
ESLIQTIFPLLTAYASGQAQAGQHVKQMRRQIYSTLISLLKSVNTGAKNQRLNRSTQALL
FNLLEQKDTQGLWATKLTRELWRRGIWDDSRAVEIMTQAALHPDVKVAIAGARFFLGADK
EREENFEDSSDEEGFDMGALKHKMEVNKKSSKRGKKLEQAVKQMKKKNSIKHSATYLNFS
AIHLLRDPQGFAEQLFDNHLSSKNSNKFDLDQKILFMNLVSRLIGTHKLIVLGIYSFFLK
YLTPKQRNVTQIMAASAQASHDLVPPESIELVVRKIADEFVSDGVAAEVASAGINTIREI
LSRAPLAIEAPLLQDLTEYKGSKSKAVMMAARSLISLYREVAPEMLSRKDRGKVASMELQ
RGEKSKSKPQYGIENNVTSIPGLELLAKWKQEHGQTNADGEEEDANWEVDDEEDGSDVEG
EWISVESDKEIDISDSEDENNDKKEDVSDLELSSDEEEEEDATEEGDDERPKKKAKLESS
SNDANNDSTMNEILSSRILTPADFAKLEELRTEAGVAKLMGITNEDAVDSTSLVGKVKYK
QLREERIAQAKEGKEDRGKFGSRKGKRDAPHSTTNKEKARKKNFVMMIHKKAVQGKQKLS
LRDRQKVLRAHIDKQKMKKK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacaaaggagagcagctatacttccaaccaacatcatattgttacaaaatgtg
gttagaagagatccagagtcttatcatgaagagtttttacaacaattatcgcattatgaa
tctttaagagatttgtacttggagaatcccacgggagctgattcaaattcaactactgag
tttattgaactaattggtttcctctcagccgtttgcaattgctatcctaaagaaacaaag
aactttcctgaagaattgaaaactatcttgcttgacaaccatcgtgatttggctcctgag
ttgagagaaaagattatacaatgtttgacaatgttgaggaataaggatatcataactgca
gaaagcttgatccaaaccatttttccattattgacagcatacgcatcaggacaggcccaa
gctggacaacatgtaaaacaaatgaggcgtcagatttattcaaccttgatttcgctatta
aaatcagtaaacactggagctaagaaccaacgactaaacagatctacacaggctttgctt
ttcaatttgctcgagcaaaaggatacacaaggtttatgggcaactaaattgactagagag
ttatggagaaggggtatttgggatgattcgagagcagttgagatcatgacacaagcagca
ttgcatcctgatgttaaagttgccattgctggtgcaaggttctttcttggtgcagataaa
gaaagagaagaaaactttgaggactccagtgatgaagaaggtttcgacatgggtgcatta
aagcataagatggaggtgaacaagaaatcatctaaaagaggaaagaagttggaacaggct
gtgaagcaaatgaaaaagaaaaatagcattaagcattcagccacctatttaaacttttca
gctattcatctattacgtgatcctcaaggttttgccgaacaattgtttgataatcacttg
agttctaaaaattcaaataagtttgatttagatcaaaagattttgttcatgaacttggtt
tcaaggttgattggtacacacaagttgattgtcttgggtatttattccttcttcttgaaa
tatctcacgccaaagcaaagaaatgtgacacaaattatggcagcatcagcccaagcttca
catgacttggttcctccagaaagtattgaattagtggttcgtaaaattgctgatgagttt
gttagtgatggagttgcagctgaagtagcatccgcaggtatcaataccattagagaaata
ctatcgcgtgctccattagcaattgaagcacctttgttgcaagatttgacggaatacaaa
ggttcaaaatcgaaagcggtcatgatggctgcaagatcattgatatcattgtacagagaa
gttgcaccggaaatgttgtccagaaaggatagaggtaaagttgccagtatggaattacaa
agaggagaaaagagcaagtccaaaccgcaatatgggattgaaaataacgttacatctatc
cctgggttagaattgttggccaaatggaaacaagaacacggacaaacaaatgccgatggt
gaagaggaagatgctaattgggaagtggatgatgaagaggatggaagtgatgttgaagga
gaatggatcctggttgaatctgataaggaaattgacatttctgatagtgaggatgagaat
aatgataagaaggaggatgtttcggatttagaattgtcatctgacgaagaggaggaggaa
gatgcaacggaagaaggtgacgatgaaaggccgaaaaagaaagccaagctcgaaagtagt
tctaatgatgcaaacaatgactctactatgaatgaaatcctttcaagtcgaatcctcaca
ccagctgattttgccaaattggaggaattaaggactgaagctggtgttgccaagttgatg
ggtatcaccaacgaagatgcggtggattctacttcattagtgggtaaagtcaaatacaag
caattgagagaagaaagaattgcacaggccaaggaaggaaaagaagaccgtggaaagttt
ggttctagaaagggtaagcgtgatgcacctcactctactactaataaagaaaaagccaga
aagaagaactttgttatgatgatccataaaaaggcagttcaaggaaagcaaaaattgtcc
ctacgtgatagacaaaaggtattaagagcccatatcgacaagcaaaagatgaagaaaaag
taa

DBGET integrated database retrieval system