KEGG   Candida orthopsilosis: CORT_0D04880Help
Entry
CORT_0D04880      CDS       T02488                                 

Definition
(RefSeq) Apg7 protein
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
cot  Candida orthopsilosis
Pathway
cot04136  Autophagy - other
cot04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:cot00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    CORT_0D04880
   04136 Autophagy - other
    CORT_0D04880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cot04131]
    CORT_0D04880
   04121 Ubiquitin system [BR:cot04121]
    CORT_0D04880
   03029 Mitochondrial biogenesis [BR:cot03029]
    CORT_0D04880
Membrane trafficking [BR:cot04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    CORT_0D04880
   Atg8 conjugation proteins
    CORT_0D04880
Ubiquitin system [BR:cot04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   CORT_0D04880
Mitochondrial biogenesis [BR:cot03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CORT_0D04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG7_N ThiF Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 14540428
NCBI-ProteinID: XP_003869463
UniProt: H8X680
Position
4:complement(955751..957640)
Genome map
AA seq 629 aa AA seqDB search
MTSIAHPKYTPTQSFIDSSFFTKLAELKLDKFKLDSSSQKIWGFQLQTQNLNKFNDTPIV
HLDDQSFSSGVPRKDDSRTFKGELINVNTIEEFKDKNKQELLRGWGWQIQDKIDKATTFD
VETFNYFYVWSYSDLKKYKFYYWVAFPILGSEWILETDGQVDAETLKMLELVTPTGQFFQ
IDSGELFDTLDIQKSHTFVYYDSCVTSEHRPSIQVKNYLYHLAQFGCKKIDLIVFRKQGS
FRQTLSLVSIPNPPKVTGWERTSQGKLSPKIADLGSLINPLELANQAVELNLKLMKWRIA
PKLDLDIIKKQKVLLLGAGTLGSYVGRTLLGWGFKDLTFVDNGRVSYSNPVRQSLFNFED
CFSDGGQGELKAQKAADNLKRVYPGVAAKGVCLEVPMIGHPVTDEERQKASFDLLDTLIE
QNDVVFLLMDSRESRWLPTVIGAVKDKIVINAALGFDSYLVMRHGSPGQSKADRLGCYFC
NDVVAPDDSLSDRTLDQMCTVTRPGGALMASSLAVELLVSILQQPEKHRAKHNDTTTFGT
TPHQIRGFLHNFSQSTLCAPGYIHCSACSERVTTEYNQNEWCFVKRCLNEQGYLEDLCGL
KKVQEEAELAIAAMSISDIEDDENSEWLE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgacttccatagcccatccaaaatatacaccaactcaatcgtttatagactcttcgttt
ttcacgaaattggctgagctaaaacttgacaaatttaagctagattcatcgagccaaaaa
atatggggctttcaactacaaactcaaaacttaaacaaatttaatgacacgccaattgtt
catctagatgaccaaagcttttccagtggagtaccccgaaaagatgacagccgaacattc
aagggggaattgataaatgtcaacaccatcgaggagttcaaggataagaacaaacaagag
cttttgagaggttggggatggcaaatacaagacaagatagacaaagcaacgacattcgac
gtggaaacattcaactacttttatgtatggagctactcggatttgaaaaagtacaagttt
tactattgggtggcctttccgatcttaggtagtgaatggatcttggagacagacggtcag
gtggacgctgagacgttaaaaatgcttgaacttgttacacctactggccaattctttcaa
attgatagtggtgaattgtttgatacattagatattcaaaaatcacacacgtttgtctac
tacgactcgtgtgttacttctgagcatagaccttccattcaggtcaagaattacttatat
cacctagctcaattcggctgtaaaaagattgacttgattgtgtttagaaagcagggctca
ttcaggcaaacactctctcttgtttcaattcctaacccacccaaggtgacagggtgggag
cgaaccagtcaaggcaaattgagtcccaaaatagccgatctaggcctgttgattaaccca
ttggaacttgcaaatcaagctgtggagctaaacttgaagttaatgaaatggaggatcgca
cccaagcttgatcttgatatcataaagaagcaaaaagtgttgcttttaggagctggaaca
ttagggagttacgtggggaggacattgttaggatgggggtttaaagatctaacatttgtt
gataatggcagagtttcctactcgaaccctgtacgacaactgcttttcaattttgaggat
tgttttagcgatggcggtcaaggtgagttgaaagctcagaaagccgctgacaatttgaaa
agggtatatccaggagttgctgcaaaaggtgtatgcttggaggtgccaatgattggccat
cctgtgactgatgaagaaagacaaaaagcatcattcgaccttttggatactctaattgag
cagaacgacgttgtatttttattgatggattcgagagagtcaaggtggcttccgactgtt
attggagccgtcaaggacaagattgttatcaatgctgccttggggttcgatagctacttg
gtcatgagacatggtagccctggccaatcaaaggcagatcgattgggctgctatttctgt
aatgatgttgtagcgccagatgatagtttaagtgaccgaactctagatcaaatgtgtacg
gtaacacgcccagggggtgcattgatggcatcctccttggctgtggagttgttagtgtca
atcttgcagcaacctgaaaagcatagggcaaaacataatgacactacaacttttggaact
acaccacatcaaattaggggtttcttgcacaacttttcacaatcaacattgtgtgcccct
ggatacatacattgctcggcttgttctgagagagtgaccactgagtacaatcaaaatgaa
tggtgttttgtaaagcgatgtttgaatgaacaaggatatttggaggacctttgtgggttg
aaaaaggtacaagaggaggcagaattggcaattgcagctatgagtattctggatattgaa
gatgatgagaatctggaatggttagaatga

DBGET integrated database retrieval system