KEGG   Candida orthopsilosis: CORT_0D04920Help
Entry
CORT_0D04920      CDS       T02488                                 

Definition
(RefSeq) Cpd1 protein
  KO
K15435  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cot03016]
    CORT_0D04920
Enzymes [BR:cot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     CORT_0D04920
Transfer RNA biogenesis [BR:cot03016]
 Eukaryotic Type
  tRNA spricing factors
   Other tRNA splicing factors
    CORT_0D04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPDase LigT_PEase MtrE
Motif
Other DBs
NCBI-GeneID: 14540432
NCBI-ProteinID: XP_003869467
UniProt: H8X684
Position
4:join(961928..961931,961981..962765)
Genome map
AA seq 262 aa AA seqDB search
MGLGVALWFCPKPNSQIHDKLTTLSSSINTLFPGSPPKFEPHITITTNVSINLDDPSKTK
DDVDKVLSACAVALQSLPKNHTNLVTIGNVNSQRKYFQKLYFEVVKDPNLVSFAQIMREV
FVIAPADIEAENQKQNPQLYTTDNNGNMVRRRPSKKHSRESSQSTIKEFDTTEIRRRARY
KAAEWAEKEYDPHISLVYSNIWPIDNALWLTIKTRISDYLGIEDVDAGNLHNHGLGWDSG
VFKLVLCEGEVQDWIVLGSVDV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggattaggtgttgctttatggttttgtccgaaaccaaactcccaaattcacgacaag
ttgacaacattgagtagttccatcaacacgttgtttccaggactgccaccaaagttcgag
ccacatatcacaataaccactaatgttagtattaacttagatgatccatccaaaacaaag
gatgatgttgataaagtgctatctgcctgcgctgtggcattacaatcattacccaaaaat
cataccaacctagtgactataggaaatgtcaacagccaacgcaaatattttcaaaaacta
tactttgaagtggtgaaagaccctaatttggtctcgtttgcccaaataatgagagaggta
tttgtcatagctccagctgatatcgaagcagaaaatcagaaacaaaatcctcagttgtac
accactgataataatggaaatatggtgaggcgaagacctctgaagaagcatagcagagaa
tcgtcacaaagcacaatcaaggaatttgacactactgagattcgaagaagggctagatat
aaggcggcagagtgggcagagaaagagtatgacccacatatatccttggtttatagtaac
atttggcccattgataatgcattgtggctaactatcaaaactagaatcagtgactatctc
ggcattgaagatgttgatgcaggaaacttacacaatcatggccttggatgggatagtggt
gttttcaaattggtgttgtgtgaaggtgaagtccaggactggattgttttgggaagcgtt
gacgtttga

DBGET integrated database retrieval system