KEGG   Candida orthopsilosis: CORT_0D04950Help
Entry
CORT_0D04950      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 BT1
Motif
Other DBs
NCBI-GeneID: 14540435
NCBI-ProteinID: XP_003869470
UniProt: H8X687
Position
4:complement(968710..970191)
Genome map
AA seq 493 aa AA seqDB search
MTPDTTSIDHEKGPTDDHLEKVSTHGSHPVSISEEHKQYLIAKHGTYDLDPLPSMSDDDP
LNWSNSFKFLQLGMVAFHGFMGTFMASGIVPSFGKYSGILNKPVPTVSYLTSAQIVLIGT
FPMFWVPVMQRYGKRLLLIISVLGTMAFSIGAVFSTDYGTLMTMRCLSAVFVSPGLAVGG
AIVKETTFSHQRGSRSGIWAISVNLGTMFGALLMGFVAEYQHPKYVHVVFACVMFVLAIC
YLLLGKETSYNPNDLSRNESNRFKQLRFKAIFPENKITIMKFIEPLMFLLKPRVFIPAFG
YTVMFMHGNIAMNVEIPQVMVHKFELGPQALGLQFLSFIIGTLIGEVGGYLSDKLVQWGH
KNNKGPSFRLWVTHPGYITCILGLIVFGVQIQNIDHYNVTPLIGCAIAAFGLQIGTSPII
AYCIDSDHTKAVQISLFVTFLRQLFAFIGPFYYPKMFDNLGFAKAYGIMAALVGAFGWIA
TSCLQVYEQRHGR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactccagatacaacttctatagatcacgaaaaaggtcctacagatgaccacttggaa
aaagtgtccactcatggttcacatccagtatctatatcagaagagcacaaacaatacctc
attgcaaaacatgggacttatgatttagatcccttaccgtcaatgagtgatgatgatcct
ttaaactggtcaaatagtttcaagtttttgcaattaggaatggtggcttttcatgggttt
atgggaacatttatggcatcgggtatagttccctcatttggtaaatactcgggcatattg
aacaaaccggtgcctacagtgtcatatttaacgtcagctcaaatcgtgctcattggtact
ttcccaatgttttgggtaccagttatgcaaaggtatggaaagaggttgttgttgatcata
tcggtattgggaaccatggcattttctattggtgctgttttcagtacagactatggaacc
ttgatgacaatgagatgtttactggcggtgtttgtatcgcctggtttggctgttggtggt
gccattgtgaaagaaactacattcagtcatcaaagaggttcacgaagtggtatttgggca
atatctgtcaacttgggaaccatgtttggtgctttacttatgggttttgttgctgaatat
cagcatccaaaatacgttcatgttgtgtttgcatgtgtcatgtttgtgttggcaatctgt
tatttgttgcttggtaaggaaacttcatacaatccaaatgacttgtcaagaaacgaatcc
aatagattcaaacaattgagatttaaagccatatttccagagaataaaatcaccattatg
aagtttattgaaccattgatgtttcttttaaaaccaagagtgtttatcccggcatttggt
tacactgtcatgtttatgcatggaaacatcgccatgaatgttgagatcccccaagtgatg
gtgcataaatttgaattaggcccacaagcattgggtttacaatttctttcattcatcata
ggtactttaattggtgaagttggtggttacttgtcggataagttggtgcaatggggccac
aaaaacaacaaaggtccaagtttcaggttatgggttacccaccctggatatatcacttgc
atccttggtttaattgtttttggtgttcaaatacaaaacattgatcactataatgtaact
ccattgattggatgtgctattgctgctttcggtttgcaaattggtacgtcgccaattata
gcttactgtattgatctggatcataccaaagcagtacaaatcagtttgtttgtgactttc
ctcagacaattgtttgccttcattggaccgttttattaccccaaaatgtttgataatttg
ggttttgctaaagcatatggtattatggcagctcttgtcggagcatttggatggattgca
acaagctgcttacaggtttatgaacagaggcatggtagatag

DBGET integrated database retrieval system