KEGG   Candida orthopsilosis: CORT_0D04990Help
Entry
CORT_0D04990      CDS       T02488                                 

Definition
(RefSeq) Pgi1 glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
cot  Candida orthopsilosis
Pathway
cot00010  Glycolysis / Gluconeogenesis
cot00030  Pentose phosphate pathway
cot00500  Starch and sucrose metabolism
cot00520  Amino sugar and nucleotide sugar metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01200  Carbon metabolism
Module
cot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cot_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CORT_0D04990
   00030 Pentose phosphate pathway
    CORT_0D04990
   00500 Starch and sucrose metabolism
    CORT_0D04990
   00520 Amino sugar and nucleotide sugar metabolism
    CORT_0D04990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cot04147]
    CORT_0D04990
Enzymes [BR:cot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     CORT_0D04990
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CORT_0D04990
  Exosomal proteins of other body fluids (saliva and urine)
   CORT_0D04990
  Exosomal proteins of colorectal cancer cells
   CORT_0D04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI Mhr1 SAP30_Sin3_bdg Nrap_D5 CRISPR_Cas9_WED
Motif
Other DBs
NCBI-GeneID: 14540439
NCBI-ProteinID: XP_003869474
UniProt: H8X691
Position
4:complement(975951..977600)
Genome map
AA seq 549 aa AA seqDB search
MSSFKLASELPAWKELEQLYKKEGEKFDVRAAFAKDPKRFDEFSRIFTNYDDSKILFDFS
KNLINQEILDKLIQLAKEAGVEKLRDEMFAGDHINTTEDRAVYHVALRNVKKHKMPVDGK
DTTQEVWDVLNHMKEFSNQVRDGEWKGYTGKAITDVINIGIGGSDLGPVMVTEALKYYSK
PGLNAHFVSNIDGTDIAEVLNKVNPETTLFLVASKTFTTAETITNATSAKKWFLDHAKDT
KHIAQHFAALSTNEKEVIKFGIDPKNMFGFESWVGGRYSVWSAIGLSVAIYIGFDNFEKF
LAGAEAVDEHFLKTPLENNIPVLGGLISVWYNNFFNAQTHLVVPYDQYLHRFPAYLQQLS
MESNGKSVTRANVFTNYQTGTILFGEPATNAQHSFFQLVHQGTKLIPADFILAAQSHNPI
ENNKHQKMLASNFFAQSEALLKGKSEEQVKAEGTTGGLVPHKEFSGNRPTTSILAQKITP
AALGALIAYYEHVTFTEGAVWNINSFDQWGVELGKVLAKVIGTELEDKKSVGSHDPSTNG
LINTFKQWE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcattcaaattagcttcagaattaccagcttggaaagaattggagcaactttac
aaaaaggagggtgaaaaattcgatgtcagggctgcatttgccaaagacccaaaaagattt
gacgaattctcccgtattttcaccaactatgatgactcaaagattctttttgacttttcc
aaaaatttgattaaccaagaaattcttgacaaattgattcaattggccaaggaagctggc
gttgagaagttgagagatgaaatgtttgctggtgatcacatcaacactactgaagacaga
gcagtttaccacgtcgcattgagaaatgtcaagaagcacaaaatgccagtcgatggtaag
gatactactcaagaagtttgggatgttttaaaccacatgaaggagttttctaatcaagtt
agagatggagaatggaaaggttacactggaaaggccattacagatgtgatcaacattggt
attggtggttcagatcttggtccagtcatggtcactgaagctttgaaatactatagtaag
ccaggcttgaatgcccactttgtatcaaacattgatggaactgatattgctgaagtgttg
aacaaggttaacccagaaacaactttgttcttggttgcttcaaaaactttcaccactgct
gaaaccatcaccaacgccacctcagcaaaaaaatggttcttagatcacgccaaagacacc
aagcacattgcccaacactttgctgccttgtccaccaatgaaaaagaagttatcaaattt
ggaattgatccaaagaacatgtttggatttgaaagctgggttggtggtcgttattctgtg
tggtcagccattggtttgtcagttgccatctacattggtttcgacaactttgaaaagttt
ttggctggtgccgaagctgttgatgaacatttcttaaagacgccattggaaaataacatc
ccagtacttggtggtttgatttctgtttggtacaacaatttctttaatgctcaaacccac
ttggttgttccttacgatcaatacttgcacagattcccagcttacttgcaacaattatct
atggaatcaaatggtaagtcagtcaccagagccaacgtttttaccaactaccaaaccggt
actatcttatttggtgaaccagctaccaatgctcaacactcttttttccaattggtccac
caaggtacaaaattgattcctgctgattttattttggctgctcaatcacacaacccaatt
gaaaacaacaaacaccagaagatgttggcttcaaacttctttgcccaatctgaagcttta
ttgaagggaaagagtgaagagcaagttaaagctgaaggtacaaccggaggtttggttcca
cataaggaattcagtggtaacagaccaactacttccatcttggctcaaaaaattactcca
gctgctttgggtgcattgattgcttattacgaacatgttacatttaccgaaggtgctgtt
tggaacatcaactcattcgaccaatggggtgttgaattgggtaaagttttggccaaagtt
attggtactgaattggaggacaagaaatctgttggttctcatgatccatccaccaacggt
ttgatcaacacgttcaaacaatgggagtag

DBGET integrated database retrieval system