KEGG   Candida orthopsilosis: CORT_0D05010Help
Entry
CORT_0D05010      CDS       T02488                                 

Definition
(RefSeq) hypothetical protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 14540441
NCBI-ProteinID: XP_003869476
UniProt: H8X693
Position
4:979459..980532
Genome map
AA seq 357 aa AA seqDB search
MNLRVVNNARFLVSLKRAVIPARQTFHPVRYFGQSGPFSRQFNKVNYDILVQNAVHMSRN
GANGTSPGGKRLPLRTILILIATSSSLSMLLYATIQYFRIRDELSQSKESNVQKSIFLPL
WLNSNILQRKTLNYPEGLRYVDMGYYNYLTTEMMQNNSNGSKSDVEEYCNELQQHQIKYA
VLEKLSSNNKIRAIFGLPLSLNPNNSKFNIWVELVHPSVSGIQMSIIQKTDSHEKNNDVS
FKWAIKPINWNSIKDDTLSPIGLGMAKIGSNAETKIHEKSSGKVHEVHQGKEKVPLNPNR
DYAIKFQSEYFITDKSANKQGKIKYIGTIDFDHLLINRGVIITDIELIYDDTSYKII
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgagagtggtaaacaatgctcgatttctagtgctgctaaagcgtgcagtgata
cccgctagacagactttccatccagttagatattttggacaaagtggtcctttttctcgt
caattcaacaaagtaaactacgacatcctagttcaaaatgcagtgcatatgagtcgtaat
ggagctaatggaacatctcccggcggaaagaggctacccctacgcactattttgatacta
atcgccacttcttcaagtttatcaatgctattatacgccactattcaatactttagaatc
agggatgaattaagtcaatctaaagaatcaaacgttcaaaaatcaatcttcttaccactt
tggcttaattcgaacattctacagagaaagacattgaattatccagaggggttgcgttac
gtggatatgggatactacaactacctaactacagagatgatgcaaaacaacagcaatgga
agtaagtcagatgttgaggagtattgtaacgagttacaacaacatcaaattaagtatgct
gttcttgaaaagctttcttcaaacaacaaaatacgagcaatatttggactacccttgagt
ctcaatccaaataattcaaaattcaacatttgggtcgagttagtacacccgagtgtatct
ggaatacaaatgagtatcattcagaagaccgattcgcatgagaagaacaatgacgtcagt
ttcaaatgggccattaaacccataaattggaattccattaaggatgacacactatcacca
attgggttggggatggccaagataggatccaatgcagagactaaaatacatgaaaaatcc
agcggcaaagttcatgaagtacaccagggtaaggaaaaagtgccgttgaatccaaataga
gactacgcaatcaaatttcaaagtgaatatttcattactgataagtctgcaaacaaacaa
ggaaaaattaagtatattggaactattgatttcgatcatttgttgatcaaccgtggggtc
atcatcaccgatattgaattgatttatgatgacacactgtataagattatatag

DBGET integrated database retrieval system