KEGG   Candida orthopsilosis: CORT_0D05070Help
Entry
CORT_0D05070      CDS       T02488                                 

Definition
(RefSeq) Ade13 adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
cot  Candida orthopsilosis
Pathway
cot00230  Purine metabolism
cot00250  Alanine, aspartate and glutamate metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
Module
cot_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
cot_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CORT_0D05070
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CORT_0D05070
Enzymes [BR:cot01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     CORT_0D05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C DUF1331
Motif
Other DBs
NCBI-GeneID: 14540447
NCBI-ProteinID: XP_003869482
UniProt: H8X699
Position
4:989795..991246
Genome map
AA seq 483 aa AA seqDB search
MVSEYDKYATPLSSRYASEEMSAIFSLRNRFSTWRKLWLNLAKAEKEVGLDMITDEAIEQ
MSKHLTITDKEIQDAAVEESKVRHDVMAHVHVFGETCPAAAGIIHLGATSCFVTDNADLI
FLRDAYDILIPKLVNVIDRLSKFALEYKDLPVLGWTHFQPAQLTTVGKRATLWLQELLWD
LRNFVRARNDIGLRGVKGTTGTQASFLSLFHGDHDKVEELDKRVVELLGFDTVYPVTGQT
YSRKIDIDVLAPLASFGATAHKFATDVRLLANLKEIEEPFEKSQIGSSAMAYKRNPMRCE
RVCSLARHLGGLFNDAVQTASVQWFERTLDDSAIRRISLPSAFLTVDILLSTMLNITSGL
VVYPKVIERRINSELPFMATENIIMAMVEKGGSRQDCHEEIRVLSHQASAVVKQEGGDND
LIERVRNTEYFKPIWGELDELLNPSTFVGRAPQQTEKFVKQDVAEALEPFEKYITEEQVA
LKV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgaatacgacaaatatgccactccattatcctcaagatatgcatctgaggag
atgtcggcaattttttccctcagaaataggttttccacgtggcgtaaattgtggttaaat
ttagccaaagctgaaaaggaagttggattagatatgattaccgacgaggcaattgaacaa
atgtcaaaacacttgactattactgataaagaaattcaagatgctgctgttgaagaaagt
aaagtgcgtcatgatgttatggcacatgttcatgtttttggtgaaacctgtcccgcagca
gctggtattattcatttaggtgcaacgtcatgttttgttactgataatgctgatttaatc
tttttaagagatgcctatgatattttaattcctaaattggttaatgttattgacagattg
agtaaatttgctttggaatataaggatttgccggtattgggatggactcatttccaacca
gctcaattaacaactgttggtaaaagagccactttatggttacaggaattattatgggat
ttgagaaactttgtcagagctagaaatgacattggattaagaggtgttaaaggtacaacg
ggtactcaagcgtccttcttgtcattgttccatggtgatcatgataaagttgaagaattg
gacaaacgtgttgttgaattattaggattcgatactgtttatccagtcaccggacaaaca
tattctcgtaagattgatattgatgtattggcaccattggccagttttggtgctactgct
cataaatttgccactgatgttaggttattggccaatttaaaggagattgaagagccattt
gaaaaatcacaaattggatccagtgccatggcttataaacgtaatccaatgagatgtgaa
cgtgtttgttcattggctagacacttgggtgggttgtttaacgatgcagttcaaactgct
tcagtacaatggtttgaaagaactttagatgactcagcaattagaagaatcagcttacct
tcagcatttttaactgttgatattttgttgtcaacaatgttgaacattacatcaggttta
gttgtttatccaaaagttattgaacgtagaatcaactcagaattaccatttatggctaca
gaaaacattatcatggcaatggttgaaaaaggtggatcaagacaagattgccatgaggaa
atcagagttttgtctcatcaagcttcagccgtggttaaacaagaaggtggtgataatgat
ttgattgaacgtgttagaaacactgaatacttcaaacctatttggggtgaattggatgaa
ttattgaatccaagtacttttgttggtagagctcctcaacaaactgaaaagttcgtcaag
caagatgttgccgaagctttggaaccttttgaaaagtacattactgaagagcaagttgca
ttgaaggtttaa

DBGET integrated database retrieval system