KEGG   Candida orthopsilosis: CORT_0F00920Help
Entry
CORT_0F00920      CDS       T02488                                 

Definition
(RefSeq) Car1 arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cot  Candida orthopsilosis
Pathway
cot00220  Arginine biosynthesis
cot00330  Arginine and proline metabolism
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01230  Biosynthesis of amino acids
Module
cot_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CORT_0F00920
   00330 Arginine and proline metabolism
    CORT_0F00920
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CORT_0F00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 14541402
NCBI-ProteinID: XP_003870451
UniProt: H8X923
Position
6:153029..153979
Genome map
AA seq 316 aa AA seqDB search
MSIEYKFHPDKKATIITAPFSGGQPKGGVELGPEYILNAGFQKQIDSLGWATRIENPLGD
VSLEEKKSNVKDEYGVKNAAIVSKCCQLIFEASKKSLSEGRLPLVIGGDHSIGTATVGAS
LAHNPNTCVVWVDAHADINSPKTTDSGNLHGCPLSFLMGIDEESYPPEYSWVPRILKSNK
LVYIGLRDVDEGEKKILRDHNIAAFSMYHIDKYGIGKVVEMALDKVNPNRNCPVHLSYDV
DAIDPSFVPATGTRVEGGLSLREGLFVAEEIAQSGLLQSLDIVETNPMLAETEEHVLDTV
SAACAIGRCALGQTLL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaatacaaatttcatcctgataaaaaagctacaataataacagcaccattt
tcaggcggtcaaccaaaaggtggtgttgaattaggtccggaatacatcttgaatgctggt
ttccaaaaacaaattgattcccttggatgggccaccagaatagagaatccattgggagat
gtatcacttgaagaaaagaaatctaatgtcaaagatgaatatggagtcaaaaatgctgct
attgttagtaaatgttgtcaattaatatttgaagctagtaaaaagagtttgagtgaaggg
aggttacctttggtaattggtggtgatcattcaattggaactgcaactgtcggtgccagt
ctagctcataatccaaatacttgcgttgtatgggttgatgcacatgctgatattaatagt
ccaaagactaccgattcaggtaatttgcatgggtgtccgttaagtttcttaatgggaatt
gatgaagaatcatatccccccgaatatagctgggttccacgtatattaaagtcaaataaa
ttggtatacattggattaagagacgtcgatgaaggtgaaaagaaaattttacgtgatcac
aacattgccgctttttcaatgtatcacattgacaaatatggtattggaaaagttgttgaa
atggcattggataaagtcaatccaaatcgtaattgtcccgtccacttatcatatgatgtc
gatgccattgatccttcatttgtaccagctactggtaccagagttgaaggtggattaagt
ttaagagaagggttatttgttgctgaagaaattgctcaactgggattattacaaagttta
gatattgttgaaaccaatccaatgttggctgagactgaggaacacgttttggatactgta
agtgctgcttgtgctattggtagatgtgctttaggacaaactttgctatag

DBGET integrated database retrieval system