KEGG   Candida orthopsilosis: CORT_0G04110Help
Entry
CORT_0G04110      CDS       T02488                                 

Definition
(RefSeq) Ife1 protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cot  Candida orthopsilosis
Pathway
cot00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CORT_0G04110
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CORT_0G04110
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CORT_0G04110
    1.1.1.-  
     CORT_0G04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 14541840
NCBI-ProteinID: XP_003871213
UniProt: H8XAB1
Position
7:844580..845716
Genome map
AA seq 378 aa AA seqDB search
MKAIVYHGKDDLRFHSDYPEPEINHPDEVKVKIDYCGICGSDLKEITSGPFFFNKPGSTN
PISNKKFPMVMGHELSGEVVAVGGNVDDLAIGDKVVVEVTGTCKDKVRFEDSPSKDKEFC
GACFDGYYNACDSLALTGLGFSDGGCAEYLVTSGDKVVKYDADKIPSDVAALVQPLAVSW
HAVGVSKFKEGQDALILGGGPIGLTTIFALKGHKAGKIVVSEPAAARRLLAEKLNVETFD
PTGKSVEECIEALRALSPDNRGFHHTFDCSGVPATFETSIKCLRIRGTATNVAVWAHKQI
PYSPMHTTMSEKIVTGSICFVKKDFVEVVRSIEAGDISVDELRLMITDKVPLEEGIEKGF
NELLYNKGDHIKILFTNN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcgtgtatcacggtaaagatgaccttagattccactccgattaccccgaa
cctgaaattaatcacccagatgaagtcaaagtaaagattgattattgtggtatctgtggc
tctgatttgaaagagatcaccagtggaccattcttcttcaataaaccaggatccacaaac
ccaatctctaacaaaaagtttccaatggtcatggggcatgagttgagtggtgaggtggtc
gcagttggtggaaatgttgacgatttggcaattggcgacaaggtggtggttgaagtgacc
ggaacgtgcaaagacaaggtacgcttcgaagactcgccctccaaggataaggaattttgt
ggtgcttgctttgatggttactacaacgcctgtgattccttggctttaacaggtcttggt
ttcagcgatggtggttgcgctgaataccttgtcaccagcggagacaaagtagtaaagtat
gatgctgataaaattcccagtgatgttgctgctttggttcaacccttagctgtttcgtgg
catgctgttggcgtttcaaaattcaaggaggggcaggatgctttgatcttaggtggtgga
ccaattgggctcaccaccatttttgcgttgaaaggtcacaaagctggtaaaatcgtggtc
agtgaacctgcagctgccagacgcttattggctgagaaattgaatgttgaaacgtttgat
ccaactggcaaatccgtcgaggaatgtattgaggcgttaagagctttgtcgccagataat
aggggttttcatcatacgtttgattgcagcggggttccagctacgtttgaaacaagtatc
aaatgtcttagaattagaggtactgccaccaatgtggctgtttgggctcataaacaaatc
ccttattctccaatgcatacaacaatgctggaaaaaattgttactggatccatttgtttt
gtcaagaaggattttgttgaagttgtgagaagtattgaagctggtgatatttcggttgat
gaactaagattgatgattactgataaggttcctttggaagagggtattgaaaaaggattc
aatgagttattgtataacaaaggtgatcatattaaaattttgtttactaataattag

DBGET integrated database retrieval system