KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0830Help
Entry
Cp162_0830        CDS       T02154                                 

Gene name
argS
Definition
(GenBank) Arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cou00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cp162_0830 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cou01007]
    Cp162_0830 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cou03016]
    Cp162_0830 (argS)
   03029 Mitochondrial biogenesis [BR:cou03029]
    Cp162_0830 (argS)
Enzymes [BR:cou01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Cp162_0830 (argS)
Amino acid related enzymes [BR:cou01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Cp162_0830 (argS)
Transfer RNA biogenesis [BR:cou03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cp162_0830 (argS)
 Prokaryotic Type
   Other AARSs
    Cp162_0830 (argS)
Mitochondrial biogenesis [BR:cou03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cp162_0830 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AFM07185
Position
complement(1497554..1499206)
Genome map
AA seq 550 aa AA seqDB search
MTPADLSHLIKRTATTILESRGLDASVLPETVVVERPRNPEHGDYATNVALQVAKKVGMN
PRELGQLLVDALALDEAVAEAGIAGPGFINIRLAAAAQGEIVAKILAAGEAFGHSDLYAG
SRVNLEFVSANPTGPIHLGGTRWAAVGDSLGRVLEASGAEVTREYYFNDHGRQIDRFTNS
LVAAAKGDPTPEDGYGGDYINDIAEAVVASHPDVLTQEPTEMLETFRSVGVEMMFSHIKE
SLHEFGTDFDVFFHENSLFESGAVDKAIERLKENGNLYFQDGAWWLKSSDYGDDKDRVVI
KSDGDAAYIAGDIAYVADKFERGHNLCIYMLGADHHGYISRLRAAAAALGYEPNSVEVLI
GQMVNLVRDGQAIRMSKRAGTVITLDDLVEAIGIDGARYSMIRSSVDSSLDIDLALWQSQ
SSDNPVYYVQYGHARLCSIARKTGDLGITAIDPNFALLTHDREGDLIRTLGEFPAVVKAA
AELREPHRVARYAEELAGTFHRFYDSCQILPKAGESPQPVHTARLALANATRQVLANALG
LVGVTAPERM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagcggatctttcacacctgattaagcgcactgctactactatccttgagtca
cgtggtctcgatgcctcggttttgcctgagacagtagtcgtggagcgcccgcgtaacccc
gaacatggggattatgcgacaaacgttgcccttcaagtggctaaaaaggtgggaatgaat
ccgcgtgagcttgggcagttgcttgtcgacgccctagctcttgatgaagccgtcgcggag
gccggtatcgccggcccgggctttatcaatattcgccttgctgctgcggcccagggggag
atcgttgctaagattctcgctgcaggtgaggcatttggtcattcagacctctatgcaggt
agccgtgtgaatctagagtttgtttctgcaaacccaacagggccgattcatctaggtggc
acccggtgggcagctgtaggagactctttaggccgcgtcttggaggcttcaggcgctgaa
gtcacaagagagtattacttcaatgatcacggacgccagatcgacagattcaccaattcg
ctcgttgctgcggcaaaaggtgaccccacgccagaagatggttatggcggagactacatc
aacgacatagcagaagctgtggttgcatcgcatcctgatgttcttactcaggagcctacg
gagatgttggagacgttccgttctgttggcgtagagatgatgtttagtcacatcaaagag
tcgctccatgaatttggtactgactttgacgtctttttccatgaaaactcattgtttgaa
tcaggcgctgttgataaagcgattgaacgcctgaaagaaaatggaaatctatatttccaa
gacggagcttggtggctcaagtcttctgattatggtgatgacaaagaccgcgttgtaatt
aagtcagatggcgatgcagcctatattgccggtgacattgcatacgtagctgacaaattc
gagcgtggacacaacctgtgtatctacatgcttggtgcagatcatcacggatatatctct
cgtttgcgtgctgctgctgcagcactggggtatgagcccaacagcgtggaggttctcatc
ggacagatggtgaatctggtccgcgatgggcaggcaattcgcatgtccaaacgcgcgggc
accgtgatcactttggatgatttagttgaggccattggcattgatggtgctcggtattcc
atgatccgatcatcggtggactctagtcttgatattgatctggcattgtggcaatcgcaa
agtagcgataaccctgtttattacgtccagtatggtcatgcacgcctgtgctcgatcgcg
aggaaaactggcgacttggggataaccgctattgaccccaattttgctttgttgacccat
gaccgtgaaggtgatctgatacgtacgctgggagagttccctgcagtagtaaaggctgcc
gctgagctgcgcgagccacatcgtgtcgcacgctatgcggaagaattggctggaacattc
catcgtttttatgattcgtgccaaatcctgcctaaagcaggtgaaagtccgcagcctgtt
cacaccgcgcgtcttgccctggctaatgccacccgtcaggttcttgctaatgccttgggc
ctggttggtgttacagcaccggagcgcatgtaa

DBGET integrated database retrieval system