KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1269Help
Entry
Cp162_1269        CDS       T02154                                 

Gene name
ribF
Definition
(GenBank) Riboflavin biosynthesis protein
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00740  Riboflavin metabolism
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cou00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Cp162_1269 (ribF)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Cp162_1269 (ribF)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Cp162_1269 (ribF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase Citrate_ly_lig CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFM07611
Position
997647..998645
Genome map
AA seq 332 aa AA seqDB search
MAKLSRVDIWHHIEDIPADLDASVITIGVFDGVHRGHRTLISAATQRARVLGVPSILVTF
NPHPLAVLRPEKMPPLLGTVAQRANLVKNLGVDHMLAMNFTANLSQLSPEDFFVSIIKDK
LKAKVVVVGENFTFGYKAAGNTETLKKLGEDYDIEIRVLELLAEDQTIVSSSVIRKALAE
GDVRRAKWGLGREFSVSGDVVRGAGRGGKELGYPTANLYFPDSIALPEDGVYAGWLQITS
AAPIDGDMVAGVRYPAAISVGHNPTFGDQRRSVESFVLDRQADLYGHSVTVEFVDRIRGM
VKFSGMEELLEAIAKDVEATREILRVDEPRKH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactatccagagtggatatctggcatcatattgaagacattccggcggatcta
gacgcctcggtcatcaccattggcgtttttgacggtgtccatcgtggtcaccgaaccttg
attagtgctgccactcaacgagcacgggtgcttggtgttcctagcatcctggttacgttt
aaccctcaccctttggcagtgcttaggccagaaaagatgcctccgttattagggacggtt
gcccaacgcgcgaaccttgtgaagaaccttggcgttgaccatatgcttgccatgaatttt
accgccaacctttcgcagctgtctccagaagatttttttgtttccattatcaaagacaag
ctcaaagcgaaggtcgttgtggtgggggagaactttacctttggctataaagcggctggt
aacacggaaactttgaagaaattgggggaagattatgacatcgagatccgtgtgttggag
ttgctggctgaagaccaaaccatagtgtcatcttctgtaatacgtaaagctcttgcagag
ggagatgtacgccgagctaaatggggattaggccgggagttttccgtcagtggagatgtg
gtgcgaggagccggcaggggaggcaaagagcttggttatccaaccgccaatctgtacttt
ccagattccattgcgttgccagaagatggtgtgtatgcgggatggctacagataacctct
gcggcacccatcgacggagatatggttgcgggagtgcgctatccagctgcaatttctgtc
ggccataaccccacgttcggtgatcagcgtcgtagcgttgaatcttttgttcttgatcgt
caagctgatttgtatgggcattccgttaccgttgaattcgtggatcgtattcgcgggatg
gtgaagttcagcggtatggaagaactgctggaggcgatagcaaaagacgtggaagctact
cgtgaaattttaagagttgatgaaccccgtaaacactag

DBGET integrated database retrieval system