KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1291Help
Entry
Cp162_1291        CDS       T02154                                 

Gene name
mqo
Definition
(GenBank) Malate quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00020  Citrate cycle (TCA cycle)
cou00620  Pyruvate metabolism
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01120  Microbial metabolism in diverse environments
cou01130  Biosynthesis of antibiotics
cou01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cou00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp162_1291 (mqo)
   00620 Pyruvate metabolism
    Cp162_1291 (mqo)
Enzymes [BR:cou01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Cp162_1291 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFM07632
Position
973747..975246
Genome map
AA seq 499 aa AA seqDB search
MADSTNAQRVTDEVDVALIGGGIMSATLGAMLRTLEPSWSQVLFERLDAPAQESSSPWNN
AGTGHSALCELNYTPEVNGRIEINKALGVNEKFQVSRQFWSYQINQGVLPNPREWINPVP
HVSFARGESQVSYLKKRYDALASHPLFPNMQYTDDRSVFNEMLPLMADGRSEFEKIAISW
TDAGTDINYGSQTRQFLKAAEANGTNIRYGHEVKDITRDSGKWKIKVKNVHTGDIQVVRA
NFVFVGAGGMALPLLQKSGIAEIRGWGGFPVSGQWLRCTNQEIIEQHSAKVYGKASIGAP
PMSVPHLDTRVIDGEKGLLFGPYAGWTPKFLKKGSYLDLFKSIHPTNLMSYLGVGAQEFG
LTKYLITEVLKDQAAQMESLREYMPNARDEDWELVTAGQRVQAIEPVVGPRFSTLAFGTS
LINSADGSIAGILGASPGASIAPAAMLEVLERCFGHRMVEWGDRIKEMIPSYGIKLSTDK
RLFEEIWNYTQTTLQLDKD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcagattccaccaacgcgcaacgcgtcacggacgaagtagacgttgccctgatcggc
ggcggtatcatgagtgccaccctgggcgctatgctccgcacacttgaacctagctggtct
caggttctctttgagcgtcttgacgcacctgctcaagagtcatcctcgccatggaataat
gcgggaacaggacattcggctctgtgtgagctgaactacacaccggaagttaacgggcgt
attgagatcaataaggctctaggtgtaaatgaaaagttccaagtttctcgccagttctgg
tcttatcaaattaaccaaggggttctcccgaatcctcgcgagtggattaaccctgtaccg
cacgtttcttttgcccgtggtgaatcgcaggttagttatttgaaaaagcgttacgacgct
ctagctagccacccattattccccaacatgcaatatacggacgaccgtagcgtgttcaat
gagatgcttccgttaatggctgatgggcgcagtgaatttgaaaaaatcgcgatttcctgg
accgatgccggcactgatattaactatgggtctcagactcgccagttcctcaaagctgcc
gaggctaatggcaccaatatccgttatggacatgaggtcaaagacattacccgcgatagt
ggtaaatggaagatcaaagtcaaaaacgttcataccggagatattcaggttgttcgtgcc
aactttgtttttgtgggcgctggaggaatggcacttccgcttctccagaagtctggaatc
gcagaaatacgtggttggggcggtttcccggtatcgggtcaatggttgcgctgtaccaac
caggaaatcatcgagcaacactcggcgaaagtttatggcaaagcatctatcggtgcgccc
ccgatgtcagtaccgcacctggatacccgcgttattgatggggaaaaaggcctgttgttt
ggtccttatgcgggatggacaccaaaattcttaaagaagggctcgtacctcgatcttttt
aagtctatccatcccacaaacctcatgtcttatctaggcgttggggctcaggaatttgga
ctaaccaagtacctcatcactgaggtactaaaggaccaagctgcccagatggagtctctg
cgtgagtacatgcctaatgctcgtgatgaagattgggagctagttacggcaggtcaacgc
gtacaggctatcgagcccgttgttggtccgcgattctccacgctggcttttggcacctcc
cttattaactcagcagatggatctatcgctggtattcttggtgcatcgccaggggcttct
attgcgccagctgcgatgttggaggttcttgagcgttgctttggacatcgcatggttgag
tggggagacaggattaaagagatgatcccttcctacggaattaaactttccacagataag
cggctatttgaggagatctggaattatacccagacaacgctgcagcttgataaagactga

DBGET integrated database retrieval system