KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1436Help
Entry
Cp162_1436        CDS       T02154                                 

Gene name
aceF
Definition
(GenBank) Oxidoreductase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00020  Citrate cycle (TCA cycle)
cou00310  Lysine degradation
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01120  Microbial metabolism in diverse environments
cou01130  Biosynthesis of antibiotics
cou01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp162_1436 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    Cp162_1436 (aceF)
Enzymes [BR:cou01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cp162_1436 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2254 Roughex
Motif
Other DBs
NCBI-ProteinID: AFM07768
Position
complement(808155..809807)
Genome map
AA seq 550 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FNEDDTVDVGDVIAIIGEEGEAPAASDSDEKKEEPKQEAPKAEPNKEAPKGSGSSTDVVM
PELGESVTEGTITQWLKSVGDTVDVDEPLLEVSTDKVDTEVPSPVAGTILEILFNEDDTV
DVGDVIVRIGEPGSEPETPKEEPAKEEPKQEAPKAEPNKEAPKEEPAKEAAKPVDNQNVP
YVTPLVRKLANKYGVDLNKVEGTGVGGRIRKQDVLAAAGQGSEPAQKEAPAAVKDPRANW
STKSVDPAKAELIGTTQKVNRIREITAKKMVEALQISAQLTHLQEVDMTNVATLRKDNKP
AFIEKYGVNLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNIAIAVDTERGLL
TPVIHKAQELTLPEIAQAIVDLADRARNNKLKPNDLSGATFTVTNIGSEGALADTPILVP
PQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGRFTATIKDRLE
KAKFQDDLNL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcaacgaagacgacaccgttgatgtcggcgatgttatcgccatcatcggtgaggaaggt
gaggctcctgccgcaagcgattctgatgagaagaaggaagagccgaagcaggaagcaccc
aaggcagaacccaacaaggaagcacctaagggctccgggtcctccaccgacgtggtcatg
cctgaactcggcgaatccgtcaccgagggaacaattacccagtggctcaagtctgtcggc
gacaccgtcgacgtcgacgaaccactactcgaggtttccaccgacaaggttgacaccgag
gttccttcccccgttgccggcaccatcctagaaatcctcttcaacgaagacgacaccgtt
gacgtcggcgacgtcatcgtccgcatcggcgaaccaggctccgaaccagaaacccctaaa
gaagagccagccaaggaagagccgaagcaggaagcacccaaggcagaacccaacaaggaa
gcacctaaggaagaaccggctaaagaggctgcaaagccagtcgataaccaaaacgttcct
tatgtgaccccattggtacgcaagcttgctaataagtacggcgttgacctcaataaggtc
gaaggcactggcgttggcggccgtatccgtaagcaagacgttctcgccgcagccgggcaa
ggatctgagccggctcaaaaagaagcccctgctgcggttaaggatcctcgcgctaactgg
tccaccaagagcgttgatcctgcaaaggcagagcttattggtaccacccagaaggtcaac
cgcatccgcgagatcacggctaagaagatggtcgaggcgttgcagatttctgcacagctc
acgcatcttcaagaggtggatatgaccaacgttgccacgctgcgcaaggacaacaagccg
gcattcatcgaaaagtatggcgttaacctgacctacctgccgttctttgttaaggccgta
gttgaggctctagtcctgcacccgaacgtgaatgcgtcttacaacgctgccaccaaggag
atcacttaccactccgacgtcaatattgcgattgcagtggataccgagcgcggtctgctc
acccctgtgatccacaaggcccaggagcttacgttgccggagatcgctcaggctattgtt
gatctggccgatcgcgcccgtaacaataagctgaagccaaacgacctatccggcgcaacc
ttcactgtgaccaatatcggttccgagggtgccttggcagataccccaatcttggttcca
ccgcaggttggtatcttgggcaccgctgcgatccagaagcgcccagtggtaatcactgag
aatggctcggacgccatcgcaatccgtcaaatgtgctacatcccgttctcttatgatcac
cagatcgtagacggcgctgatgccggtcgcttcaccgcgacgatcaaggatcgcctggaa
aaggctaagttccaggacgacctcaacctctaa

DBGET integrated database retrieval system