KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1615Help
Entry
Cp162_1615        CDS       T02154                                 

Gene name
yddQ
Definition
(GenBank) Isochorismatase family protein
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00760  Nicotinate and nicotinamide metabolism
cou01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Cp162_1615 (yddQ)
Enzymes [BR:cou01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Cp162_1615 (yddQ)
    3.5.1.-  
     Cp162_1615 (yddQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: AFM07943
Position
1808475..1809137
Genome map
AA seq 220 aa AA seqDB search
MSTTLTPFLTPIQRSSMQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKG
AIQAQSIAEYTASHREKYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHP
LLSNMHFDEVFYKGHYSAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATA
LDGLREGFRVTVLSHLCAAVNEDNTHTVLHQLKEHGCVLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacaacacttaccccctttttaaccccaatacagcgttcttccatgcagcgtgta
ttctcatatgcattttgtactatccttgtgccctctcagaaagaaaatatgcgagccctc
atcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaaacggtcaagggc
gcaatccaagcacaatccattgcagaatacacggcgtctcatagggaaaaatacgactgc
atcgcagccaccaaagattggcacattgaccccggcgatcatttttctcagacaccagac
tttattgactcctggcccgtacattgcatagctaacacggaaggcgccgattttcaccca
ttgctctcaaacatgcactttgatgaggttttttataaggggcactatagtgcggcttac
tcggggttcgaggggtccacagcatctggagagttattaggtgaatggttaaagaatcgc
gggatacgcgagattgatatcgcgggaatcgctacggattattgcgttcaggctacggct
cttgacggtttaagagaaggcttccgtgtgacggtgctctcgcacctttgcgccgcagtc
aacgaggacaacacccacacagttttgcatcaactcaaagagcatggatgtgtccttgtt
taa

DBGET integrated database retrieval system