KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1884Help
Entry
Cp162_1884        CDS       T02154                                 

Gene name
pitB
Definition
(GenBank) Phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Brite
KEGG Orthology (KO) [BR:cou00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cp162_1884 (pitB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF443
Motif
Other DBs
NCBI-ProteinID: AFM08195
Position
complement(2124126..2125730)
Genome map
AA seq 534 aa AA seqDB search
MADSAMLTTPSTEDAGSDRWWHLTFGGLLAVTLLVFALWSFGYVGDTANKGILITTILFG
VFMAFNIGGNDVANSFGTSVGAGTLTMKQALIVAAIFEVSGAVLAGGEVTDTVKSGIVDL
DAIDLSPHHFAFIMMASLLGAAVWLLLATRMGWPVSTTHSIIGGIVGASLVLGFSQGLGG
WEMVQWGEIGQIALSWVLSPVLGGLAAWLLFGFIKKHILVYNEGADEQLRQIKADRIELH
KSFKASFERLNEIQQLAYTNAMTRDAALIQERDFDPSELESEYYRDLYRINHRRDNLNTH
QALENWVPLLAAGGAALIGAMMLFKGLKNLNLHISTLGNVLILGMVSVVVWMAVLIFSRT
LKQQELSRATFVIFSWMQVFTASAFAFSHGSNDIANAIGPFSAVLDVLRTDSINGKAAVP
TALMITCGVALIAGLWFIGRYVIHTVGAGLTEMHPASGFSAELAAAAVVMGASVLGLPVS
STHILIGAILGIGIVNKAANWRLMKPIAMAWVITLPAAAFVSGVAVFVLNAVWG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgctatgctgaccacaccatccactgaggatgcaggttcggatcgatgg
tggcatcttacgtttggtggacttttagcagtcacgctgcttgtttttgccctgtggtca
ttcggctatgtgggtgatacagccaacaagggcattctgattaccacgatattgtttggt
gttttcatggccttcaatattggtggcaatgacgtggccaattcctttggaacttccgtg
ggggcagggaccctcactatgaagcaggctctaatcgttgcggccatctttgaggtttct
ggtgcggttctcgctggtggcgaggttactgacacggttaaatccgggatcgtagacctt
gacgctatagatttaagcccgcatcactttgccttcattatgatggcctctcttctgggg
gcggcggtgtggttattgctagctacccgtatgggatggccagtgtccacaacccactcg
atcatcggcggcatcgttggagcttcccttgtgttgggctttagtcagggccttggcggc
tgggagatggtgcagtggggggaaatcggtcagatcgcattgtcctgggttctttctccc
gtgctaggtgggctggctgcgtggctgctgtttggctttattaaaaagcacatcctggtt
tataacgaaggcgcggatgagcaattgcgccagatcaaggctgatcgcattgagctgcat
aagtctttcaaggcctcttttgagcggttgaatgagatccagcagctcgcgtacacaaat
gccatgacgcgcgacgccgccttgattcaggagcgcgattttgaccctagcgagctagag
tccgagtactatcgcgacctctaccgtattaatcaccggcgcgataacctcaacactcac
caggcccttgagaattgggtgccgttgctcgctgcgggtggagcggctctgatcggtgcc
atgatgctctttaaggggctgaaaaaccttaacctgcacatcagcacgctggggaacgta
ctgatccttgggatggtctctgtcgttgtgtggatggcggttttgattttttctcggact
ctcaagcagcaagagctttctcgtgcaacgtttgtcatattctcctggatgcaggttttt
acagcatcggcattcgccttctctcacggttccaatgacatcgctaatgcgatcggtccg
ttctctgcggtgcttgatgttctgcggaccgacagtattaacggcaaggcggcggttcct
accgcactgatgattacgtgcggtgttgcgttgattgccggcctgtggtttatcgggcgc
tacgtgattcatacggtgggggcagggctaacggagatgcatccggcatccgggttctct
gctgagttggctgcggctgctgtggtgatgggggcctctgtccttggtcttcctgtctcc
tctactcacattctgattggtgcaatcctaggtattggaattgtgaacaaggccgccaat
tggcgattaatgaagcccatcgcgatggcctgggtgattacgcttccggctgcggccttt
gtgtcgggcgtggctgtgtttgtattaaacgctgtgtggggataa

DBGET integrated database retrieval system