KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_2040Help
Entry
Cp162_2040        CDS       T02154                                 

Gene name
nanK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00010  Glycolysis / Gluconeogenesis
cou00052  Galactose metabolism
cou00500  Starch and sucrose metabolism
cou00520  Amino sugar and nucleotide sugar metabolism
cou00521  Streptomycin biosynthesis
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01120  Microbial metabolism in diverse environments
cou01130  Biosynthesis of antibiotics
cou01200  Carbon metabolism
Module
cou_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp162_2040 (nanK)
   00052 Galactose metabolism
    Cp162_2040 (nanK)
   00500 Starch and sucrose metabolism
    Cp162_2040 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp162_2040 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp162_2040 (nanK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp162_2040 (nanK)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp162_2040 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF320
Motif
Other DBs
NCBI-ProteinID: AFM08347
Position
complement(2312401..2313336)
Genome map
AA seq 311 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLAASYNAHAENPAVDLHEIMTRYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQDQINKVSI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtgcgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagatgtctcccctactgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgctgcctcctataacgcgcatgcg
gagaacccagccgtggatctccacgagattatgactcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcctgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtgggagccgcatatctgggg
aagacccaagaccaaatcaacaaagtatctatttaa

DBGET integrated database retrieval system