KEGG   Colwellia sp. Arc7-635: EKO29_03785Help
Entry
EKO29_03785       CDS       T06022                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cov  Colwellia sp. Arc7-635
Brite
KEGG Orthology (KO) [BR:cov00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EKO29_03785 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AZQ86201
UniProt: A0A3Q9GBG2
Position
complement(865852..866226)
Genome map
AA seq 124 aa AA seqDB search
MITTDVSVSVVSQYIAQQSVEAEQQFVFSYTITITNNSAETVQLLSRYWLITDANGDTSE
VSGEGVIGQQPYIKVNESFTYSSGCLLKSPLGNMQGHYQMQTSSAKLIQVDIPVFRLAKP
NILN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgataacaactgacgtttcggtgtcagttgttagccaatacattgctcagcaatctgtt
gaggctgagcaacaatttgtcttcagttatactattactattaccaacaatagcgctgaa
accgttcaacttttaagccgttattggctgattacagatgcgaatggcgacactagcgaa
gtgtcaggtgaaggtgttattggtcagcagccttatattaaggtaaacgaaagttttact
tatagtagtggttgtttattaaagtctcccctaggcaatatgcaagggcattatcaaatg
caaacaagttcggcaaaattgattcaggttgatattcccgtatttcgtttagcaaaaccc
aacatattaaattag

DBGET integrated database retrieval system