KEGG   Colwellia sp. Arc7-635: EKO29_07765Help
Entry
EKO29_07765       CDS       T06022                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cov  Colwellia sp. Arc7-635
Pathway
cov00450  Selenocompound metabolism
cov00970  Aminoacyl-tRNA biosynthesis
cov01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EKO29_07765
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EKO29_07765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cov01007]
    EKO29_07765
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cov03016]
    EKO29_07765
Enzymes [BR:cov01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EKO29_07765
Amino acid related enzymes [BR:cov01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EKO29_07765
Transfer RNA biogenesis [BR:cov03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EKO29_07765
 Prokaryotic type
   Other AARSs
    EKO29_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZQ83927
UniProt: A0A3Q9G5P1
Position
complement(1772154..1774280)
Genome map
AA seq 708 aa AA seqDB search
MSLSKSSVPSADKRKILVTCALPYANGSIHLGHLLEHIQTDIWVRFQRMRGHETYFVCAD
DAHGTPIMLKAQELGITPEEMITGVREERIKEFSDFHISFDNYHTTHSDENKEYSEKIYN
ALHAKGHIKTRTISQLYDPEKGMFLADRFVKGTCPKCKSEDENGDSCDNCGATYSPTEVL
NPRSAISGATPILKDSEHYFFDLPAFETMLADWIRSGSLQEEVANKLTEWFEQGLKQWDI
SRDAPYFGFEIPNAPGKFFYVWLDAPIGYMGSFKNLCDRDSSIDFDSFWNKDSDAELYHF
IGKDIINFHSLFWPAMLEGADFRKPTAVFAHGFVTVNGEKMSKSKGTFIKGRTYLDHLNP
EYLRYYYATKLTHKIDDLDLNLEDFVQRVNSDLVGKVVNIASRCASFITKRFDGMLSTNV
DNQELADEVMAAGDSIAAHYEARDFGRGMREIMALADKVNEYIAIKEPWQLVKDETKQQE
VQDICSLGINMFRTLMIYLKPVLPVLADSTAEFLNDELVWEGHKTLLTDHKINKFKALLQ
RVDMDKVNAMTDASKENLLVKADDEKPAKAKKKAKQEKVVDNTAALNDPLGSDPISEEIQ
FDDFAKIDLRIAKIVNAEHVEKADKLLKLTLALDSLENGETRQVFAGIKSAYQPEDLIGK
LTVMVANLAPRKMRFGMSEGMVLAAGPGGKDLWILNPDDGAQPGMRVK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatcaaagtcatctgtaccatctgcagataaacgtaaaattttagttacttgt
gcccttccttatgcgaatggctcgattcaccttggccatttattagagcatattcaaact
gatatttgggttcgtttccaacgtatgcgtggtcatgaaacttactttgtttgtgccgat
gacgctcatggcacaccgatcatgctaaaagcacaagagcttggcataacacctgaagaa
atgatcacaggtgtgcgtgaagaacgtattaaagaatttagtgactttcacattagcttt
gataattaccacacaacacatagcgatgaaaacaaagagtactctgaaaaaatttataac
gctttacatgcaaaaggtcatattaaaacccgtactatttctcagttatacgatcctgaa
aaaggcatgttcttagctgaccgatttgtaaaaggtacttgtccgaaatgtaaaagtgaa
gatgaaaatggtgatagctgtgacaactgtggcgcaacgtattcaccaacagaagtactt
aacccacgttctgctatttcaggtgctacacccatattaaaagactctgaacattacttc
ttcgacttacctgcttttgaaaccatgttagcagactggatacgcagtggctcattgcaa
gaagaagtagcgaataagcttactgaatggttcgaacaaggattaaagcagtgggatatt
agccgtgacgcaccttattttggttttgaaataccgaatgcgccgggtaaattcttctat
gtttggttagacgcgcctattggttatatgggcagctttaaaaacctatgtgatagagac
tcgagcatcgactttgacagcttttggaataaagattcagacgctgagctataccatttt
atcggtaaagacattattaacttccacagcctgttttggcctgcgatgttagaaggtgct
gatttccgtaaacctacggctgttttcgctcatggttttgttaccgtgaacggtgagaaa
atgtctaaatctaaaggcactttcatcaaaggtcgtacgtacttagatcacttaaaccca
gagtacttacgttattattacgcgactaaattaacccacaaaattgacgatttagattta
aatcttgaagacttcgtacaacgtgttaactctgacttagtcggtaaagtggttaatatc
gcttctcgttgtgcaagttttatcactaaacgctttgacggcatgttatcaactaacgtt
gataaccaagaattagcagatgaagtaatggctgcaggcgatagcattgctgctcattac
gaagcacgtgatttcggccgcggtatgcgcgaaattatggcacttgctgataaagtcaat
gaatacatcgcgattaaagaaccatggcagttagttaaagacgaaactaaacaacaagaa
gtacaagatatctgttcattgggtatcaatatgttccgtaccttgatgatttacttaaaa
ccggtactacccgttttagctgacagcacagctgagtttttaaatgatgaattagtatgg
gaaggtcacaaaaccttactaaccgatcataaaatcaataaatttaaagcattattacaa
cgtgttgatatggataaagtcaatgcgatgactgacgcttcaaaagaaaatttattggta
aaagcagatgacgaaaagccagctaaagcaaaaaagaaagctaagcaggaaaaagttgtt
gataataccgctgcattaaatgacccattgggcagcgatcctatcagcgaagaaattcaa
tttgatgattttgctaaaatagatttacgtattgcaaaaattgttaatgctgagcatgtt
gaaaaagctgataaattactcaaattaaccttagcacttgatagcctggaaaatggcgaa
actcgtcaagtatttgccggcataaagtcagcatatcaaccggaagatttaattggcaaa
cttaccgttatggttgctaacttagcgccacgtaaaatgcgctttggtatgtcagaaggt
atggtgctagctgcaggtccaggtggtaaagatttatggatacttaatcctgatgacggt
gcacagccaggtatgcgagtaaagtag

DBGET integrated database retrieval system