KEGG   Caldicellulosiruptor owensensis: Calow_0481Help
Entry
Calow_0481        CDS       T01347                                 

Definition
(GenBank) Arabinogalactan endo-1,4-beta-galactosidase
  KO
K01224  arabinogalactan endo-1,4-beta-galactosidase [EC:3.2.1.89]
Organism
cow  Caldicellulosiruptor owensensis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Calow_0481
Enzymes [BR:cow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.89  arabinogalactan endo-beta-1,4-galactanase
     Calow_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_53 Big_4
Motif
Other DBs
NCBI-ProteinID: ADQ04064
UniProt: E4Q4A2
Position
553798..556266
Genome map
AA seq 822 aa AA seqDB search
MDSLLDFHYSDFWADPGKQDKPKAWANLSFDELKQAVYQYTYDIIKMYKDQGALPDMVQV
GNEVNGGMLWPDGKTWGEDAGGYDNFAELLKAGIRGVRDAAGPDNQVKIMIHLANGGDNE
LYRRVFDNLTQGGVEFDVIGLSYYPYWHGKLSDLIYNMNDISKRYNKEVVIAETAYAYTL
ENGDGLNNIFGTREAATAGYEPSVQNQALVIRNIANAVVQVPGGKGLGIFYWEPDWIPVE
GAGWKTGEGNGWDNQAMFDFNGNALDSLYVFKMLNNIMIVDYKPVVVGTVPGEMPKLPAK
ITAVLSNGLTKEVDVTWDSIDPSKYAQTGSFEVCGHVEGSEVTPVAKVKVANLIQNSGFE
DDLNGWNVEGQTGAANANSSAPVRSGNKKLNIWYGSPYNLVISQTITGLGQGKYTFKAWF
VNTGSAQKRDIVIKDYGGQEIKIQIPQSAAWDAWTPAEINDINVTTGKCTISFEIAADSG
FWCAIDDVLFYRQDPDIEKNIVSVQRLDITTEVGQKPQLPPTVMVVYDDDTSSEANVTWE
AIDESKYSAIGEFTVTGVVEGTTLKAYAKVKVINSKNLVKNYSFEEGLKYWISEGNTNAV
KTESGGHSGGTQLTHWSDKPYKVVTYQTIENIPNGIYIFRAFANGGGGQNANYLFVKDYG
GEELRINMPTKWVAEWHKMVIANIKVTTGRVTIGLYSDSENAGGTWCNLDDVEFFKVADR
EFEISNANLQKDKGLIASVTVKQSEGIQHDGKEVVVFELLKGTTPISIVAVEKDIVGVED
FKAYFNVNDYLSTDYRVKVFVFDKFDTSLTVPNSLAEPIELR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
ttggacagcctccttgattttcattacagtgacttttgggcagacccaggaaaacaagac
aagccaaaagcatgggcaaatctttcatttgatgaactaaaacaggcagtttaccagtat
acttatgacatcataaaaatgtacaaagatcaaggtgcacttcctgacatggttcaggtt
ggaaatgaggttaatggcggtatgctctggccggacggaaaaacatggggcgaagatgct
ggaggatatgacaattttgcagagcttctaaaggcagggattagaggtgtaagggatgca
gctggtcctgataatcaggtgaagattatgattcaccttgctaacggaggggacaatgaa
ctatacagaagagtatttgacaatttgacgcagggcggtgttgagtttgatgtaattgga
ctttcatattacccatactggcatggaaaacttagtgatttaatctacaatatgaatgat
attagcaaaagatataacaaagaggtagttattgcagaaacagcgtatgcatacacttta
gaaaatggagatggactgaataatatctttggcacaagggaagctgcaacagctgggtat
gagccatcagtccaaaatcaagcactggttatcagaaacattgcaaatgctgtagtacaa
gttccaggtggcaaaggacttggcatattctattgggagccagattggatacctgttgaa
ggtgctggctggaagacaggcgaaggaaatggatgggataaccaagctatgtttgatttt
aatggaaatgctttggattctctgtatgtgttcaagatgctcaataacatcatgattgta
gattataaaccagttgttgttggaacagttccaggtgaaatgccaaaacttcctgctaaa
atcacagctgttttaagcaatggtcttacaaaagaggttgatgtcacatgggacagtatt
gacccgtcaaaatatgcccaaactggtagctttgaagtttgtgggcatgttgaaggtagc
gaggttacacctgttgcaaaagtaaaagtagcaaatcttatacaaaattctggctttgaa
gatgatttgaatggatggaatgtagaggggcaaactggagcagcaaatgcaaatagtagt
gcacctgtccgttctggaaacaagaaattaaatatttggtatggatcgccatacaatctt
gtaatatctcaaacaattacaggcttagggcaaggcaagtatacatttaaagcatggttt
gttaacactggtagtgctcaaaaacgtgatattgtaataaaagattatggtgggcaggaa
ataaaaatacaaattccacaatcagctgcatgggatgcttggacacctgctgaaataaat
gatattaatgttacaacaggaaagtgcacaatttcatttgaaattgctgctgattcaggt
ttttggtgtgcaatagacgatgttctattctatcgccaggacccagatatcgaaaagaat
atagtgagtgttcaaagattagatattacaacagaggtagggcaaaagcctcagcttccg
ccaactgtcatggtggtttatgatgatgatacatcctctgaggcaaatgttacatgggaa
gctattgatgagagtaaatactcagcgattggtgaatttactgttacaggtgttgtagaa
ggcacaaccctaaaagcatatgccaaagtaaaggttatcaatagcaaaaatcttgtaaaa
aattatagttttgaagaggggctaaagtattggataagcgaaggaaatactaatgctgtc
aaaactgaaagtggagggcattcgggaggaacgcagcttactcactggagtgacaagcct
tacaaggtggtcacatatcaaacaatcgaaaatataccaaatggtatatacatcttcaga
gcctttgcaaatggaggcggcggccagaatgctaactacctgtttgtaaaagactatggt
ggagaagaactgagaataaatatgccgaccaaatgggtcgcagagtggcacaaaatggtg
attgcaaacattaaagttaccactggacgcgttacaatagggctttattcagattcagaa
aatgcaggaggtacatggtgcaaccttgatgatgttgaatttttcaaagttgctgacagg
gaatttgaaatttcaaatgcaaatctgcaaaaggataaaggacttattgcaagtgttacg
gtaaaacaatcagaaggtattcagcatgatggcaaagaagttgtagtgtttgaactatta
aaagggacaactcctatttcaattgttgctgttgaaaaggatatagtaggagttgaagac
tttaaggcttactttaatgtaaatgattatctgagcactgactacagggtaaaagtattt
gtgtttgacaaatttgacacaagtctcactgttccaaatagccttgctgagcctattgag
cttcgatga

DBGET integrated database retrieval system