KEGG   Caldicellulosiruptor owensensis: Calow_0531Help
Entry
Calow_0531        CDS       T01347                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00260  Glycine, serine and threonine metabolism
cow00750  Vitamin B6 metabolism
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01120  Microbial metabolism in diverse environments
cow01230  Biosynthesis of amino acids
Module
cow_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calow_0531
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calow_0531
Enzymes [BR:cow01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calow_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADQ04113
UniProt: E4Q4F1
Position
611276..612766
Genome map
AA seq 496 aa AA seqDB search
MKWMRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPPLDLSKIKNIDSYANLAKYIFE
LYLTDFTNEEIADCIDKSYSRGKFDTKDVVAIKKLSPSLFALELWHGPTYAFKDVALQVL
PHLLLKSMPTFYKQALILVATSGDTGKAALEGFRDVDRTKIVVFYPSEGVSDVQKRQMTT
QEGRNTFVAGIKGNFDDAQSGVKEIFTDKRCIDTIENMGFFFTSANSINFGRLLPQIVYY
IWSYLVLLKNDDIREGEKINFVVPTGNFGNILAGFIAKLMGIPINKLIVASNINSVVADF
IRTGLYDRRREFYKTISPSMDILVASNLERLLYLITKDSEKVKKYMLDLKTEGYFKVEEE
VLKEIQESFWGDFSTDDQTRNSIKTIYSEYGYLVDPHSAVGFDVYSKYLKQTLDSTKTVV
LQTANPYKFAKDVLNALFDGEYNNIDPFEAVEVLQKRTCVEAPEGIKNLISKPILHPDVI
EKEKMFDFILEKIRDN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatggatgcgatatataagtacaagaggaaataaagaggtgcaggcaaaagaggcc
atttacaggggaatagctgaggatggtgggctttacacccctgtttcaattcctcctctt
gatttaagtaagataaaaaacatagactcttacgcaaatcttgcaaaatatatatttgag
ctctaccttactgattttacgaatgaagaaattgctgattgcattgacaagtcatacagc
cgtggcaagtttgacacaaaagatgttgtggctatcaaaaagctcagcccgagtcttttt
gcacttgagctgtggcatggtccgacttacgctttcaaagatgttgcattgcaggtgcta
cctcatcttttgctaaaatcaatgccaactttttacaaacaggcactcatacttgttgca
acatcaggcgatactggcaaggctgcgttggaaggatttagggatgtggatagaacaaag
atagttgtgttttatccatctgagggtgtatctgatgttcaaaaaagacagatgacaacc
caggagggcagaaacacttttgttgccgggataaaaggcaattttgacgatgcccaatcc
ggtgtgaaggagatttttacagacaaaagatgcatagatacaatcgaaaatatgggcttt
ttctttacttctgcaaactcaataaattttggtaggcttcttccacagattgtatactac
atctggagctaccttgtgcttttaaagaatgatgatattcgcgaaggtgaaaaaataaac
tttgttgttccgacaggaaattttggtaatatattggcaggctttattgcaaagctcatg
ggaatccctataaataagcttattgttgcttcgaacataaacagtgttgttgcagatttt
atcaggacaggtttgtacgacagaagaagagaattttacaaaacaatctcaccttcaatg
gacatccttgttgcaagtaatctggagaggttattgtatttgataacaaaagattcggaa
aaagtaaaaaaatacatgttagatttgaagactgaggggtatttcaaagttgaagaggaa
gttttaaaagagattcaagagagtttctggggcgatttttccacagatgaccagacaaga
aatagtataaagactatttacagcgaatatggttatcttgttgacccgcactctgctgtt
gggtttgatgtttacagcaagtacttaaagcaaaccttggatagtacaaaaacggttgtg
ctacaaactgcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggt
gaatataataatattgacccgtttgaagcggttgaggttttgcaaaaaaggacatgtgtt
gaagcacctgaaggaataaaaaatcttatttcaaagccaattttgcatcctgatgtgata
gaaaaagagaaaatgtttgattttatattagagaaaataagagataattga

DBGET integrated database retrieval system