KEGG   Caldicellulosiruptor owensensis: Calow_1184Help
Entry
Calow_1184        CDS       T01347                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00051  Fructose and mannose metabolism
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
cow01230  Biosynthesis of amino acids
Module
cow_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cow_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_1184
   00051 Fructose and mannose metabolism
    Calow_1184
   00562 Inositol phosphate metabolism
    Calow_1184
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Calow_1184
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calow_1184
Exosome [BR:cow04147]
 Exosomal proteins
  Proteins found in most exosomes
   Calow_1184
  Exosomal proteins of colorectal cancer cells
   Calow_1184
  Exosomal proteins of bladder cancer cells
   Calow_1184
  Exosomal proteins of melanoma cells
   Calow_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM DREPP SIS_2
Motif
Other DBs
NCBI-ProteinID: ADQ04742
UniProt: E4Q1K8
Position
complement(1266406..1268358)
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVAGKRVLVRVDFNVPQDENGNITDDRRIKEALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVAQMKEGDVVLLEN
VRFHKEEEENDREFAKALASVADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVIMNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPQE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRKVIAEIYD
EDTAQKVRIQYGGSVNSANSAEIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctgaataagaagaccataagagatatagatgttgccggtaaaagagttctt
gtgagggttgattttaatgttcctcaagatgaaaatggtaatattacagacgatagaaga
ataaaagaagctcttcctacaataaagtatcttattgaccacaacgcaaaggtaattttg
gtatctcatttgggaagaccaaaaggcaaatttgatccaaaatactcaatggctcctgtt
gctaaaaggctttctgagcttctcggtaaggaagttgttcttgcaaaagacgttataggc
gatgatgcaaaaaagtgtgttgcacagatgaaagaaggagatgtagttcttcttgaaaat
gtcagattccacaaagaggaagaagaaaatgatagagaatttgcaaaggctttagcatcg
gttgcagacatttatgtaaatgatgcgtttggtacagctcatagagcacatgcatcaaca
gctggtgttgcagagttcttaccagcagttgctggatttttgatggaaaaagaaatagaa
atgcttggcaatgctcttgcaaatccgcagaggccttttgttgcgatcctgggtggagca
aaagtttctgataagataggagttattatgaacctacttgaaaaggttgatagtctgtta
attggcggtgcaatggcttatactttcttaaaagcgaaaggatataagattggtaaatca
aaatgcgaagatgataagcttgatgttgcaagagagataatgaaaaaggcagaagaaaag
ggagtaaaccttcttttgcctgttggaagcatagtagcaaaagaatttaaaaatgataca
gaatttatgtatgtaccatcagatgcaatgccagatgatatgatgggaatggacattgga
aatactacaattgagttattctccaaggaaataaagaaggcaaagacaattgtttggaac
ggaccaatgggcgtgtttgagtttccgaacttcgcaaaagggacagaagctattgcaaga
gctgttgctgaggctgttgaagaaaatggtgcaattgcaattatcggcggcggtgactct
gcagctgctgttgaaaaactggggtttgctgataagatgacacatatctcaacaggcggc
ggtgcttcattagagttcttggaaggcaaagttttaccaggtattgcatgtcttcttgat
aaaaatccaaggaagaagataattgcagcaaactggaagatgaacaagactccacaagaa
gcaaaagagtttgttgaagagctgaagaagtatattgatgatgtgcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgtcaaagaagcaatagaaggaacaaatata
aaactcggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctcc
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cagtactttggtgaaacagacgaaattgtgaacaaaaaagttctggcagcgctgaaattt
ggtataaaacctattgtatgtgtcggtgagactttaaagcaaagagaatatggcattaca
gatgagcttgtaaggcttcaggtcaagattgcactaaatggtgtctcaaaagaagatgtt
gaaaaagtggtcattgcatatgagcctatctgggcaataggtactggcaaaaacgcaaca
cctgaagaagcaaatagggtaattggtgttatcagaaaggtaattgcagaaatttacgat
gaagataccgcgcaaaaggttaggatccagtatggtggtagtgtaaactctgcaaattca
gcagagattttcaatatgccagagattgatggaggattagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system