KEGG   Caldicellulosiruptor owensensis: Calow_1264Help
Entry
Calow_1264        CDS       T01347                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cow  Caldicellulosiruptor owensensis
Brite
KEGG Orthology (KO) [BR:cow00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Calow_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADQ04822
UniProt: E4Q204
Position
1346619..1347617
Genome map
AA seq 332 aa AA seqDB search
MHNISLNLLLIIILALTFDFINGFHDTANAIATSVSTRVLTPRTAIFMSAVFNFFGAMIN
TEVAKTIGHGIVSPRFVTQNLVLAAVIAAIVWDLITWWWGIPSSSSHAIIGGLVGAAIAT
TKSLVDINWIGFVKKIVIPLIVSPILGFVFGYLFMMILYILFAKAHPTIVNRYFSKLQIV
SAMWMAYSHGSNDAQKSMGIITMALVGSGILNEFVVPSWVKFACALAMALGTSAGGWRII
KTMGIKIIKLAPINGFAAETGAALTIQFATHIGAPVSTTHVISSSIMGVGACKKFSAVRW
GIARNIVIAWVLTIPMCAILGAIISILINGIA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcataacatatcactgaacctgcttttaataatcattttagcgctgacttttgacttt
ataaatgggtttcatgatacagcaaacgcaattgcaacttcagtttcaacaagagtttta
acaccccgtactgccatatttatgtcagcagtttttaacttctttggtgcaatgataaac
acagaggttgctaaaactattggccatggaattgtttctccgagatttgttacacaaaat
cttgtacttgcagctgtgattgcagcaattgtttgggacctgattacgtggtggtgggga
ataccttcttcttcatcacatgcaataattggtggtcttgtaggcgctgcaattgccaca
acaaagtcacttgttgatattaattggatagggtttgttaaaaagattgttattcctttg
attgtttctcccattttgggttttgtatttggatatttatttatgatgattctttacata
ttgttcgctaaagcacatccaacaattgtaaatagatacttttcaaaattacaaattgtc
tccgcaatgtggatggcatacagtcatggctcaaatgatgctcaaaaatccatgggaata
ataaccatggcactggtaggaagtggaattttaaatgagtttgttgtaccaagctgggtc
aaatttgcctgtgctcttgccatggctttaggtacatcagcaggtggctggcgaataatt
aaaacaatgggaataaagataataaaacttgcaccaataaacggctttgcagcagagact
ggtgcagccctaacaattcagtttgcaactcatattggtgcaccagtttccaccacccac
gttatttcgtcttctattatgggggtaggtgcatgtaaaaagttttcagctgttagatgg
gggattgcaagaaatattgttattgcatgggttttgacaatcccaatgtgtgctatttta
ggagctatcatttctatcttaattaatgggatagcatag

DBGET integrated database retrieval system