KEGG   Caldicellulosiruptor owensensis: Calow_1723Help
Entry
Calow_1723        CDS       T01347                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00471  D-Glutamine and D-glutamate metabolism
cow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Calow_1723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cow01011]
    Calow_1723
Enzymes [BR:cow01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Calow_1723
Peptidoglycan biosynthesis and degradation proteins [BR:cow01011]
 Precursor biosynthesis
  Racemase
   Calow_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADQ05261
UniProt: E4Q4I2
Position
complement(1803877..1804680)
Genome map
AA seq 267 aa AA seqDB search
MDLRPIGIFDSGLGGLTVFKEIVSLMPNESIVYFGDTARIPYGSKSKETVTKFAMQNTRF
LLSKNVKIVVVACNTASAYAYEALKAKFDIPIVAVIEPGAEAAVRATKNKKIGVIGTEGT
IASGSFEKKILELDSSIKVFSKPCPLFVPLVEEGWTDKEVTYLVAKEYLEEFIEKEIDTL
VLGCTHYPFLQDVIKKVLPDVILINPARETAKRVFEVLKENDILNSSCEEPTYYFYASDN
LKKFESVASIFLNEKIKCEEKIDIEKY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggatttgcgaccgatcggtatatttgattctggtttgggtggacttactgtcttcaaa
gagattgtaagtcttatgccaaatgagagcattgtatattttggtgacacggcaagaatt
ccatatggttctaaatctaaagagactgttacaaagtttgcaatgcaaaacacaaggttt
ttgttatcaaaaaatgttaagattgtggttgtggcatgtaacactgcctctgcgtatgca
tatgaagctttgaaagcaaaatttgacattcccattgttgcagtaattgaacctggagct
gaagcagcagtaagggctactaaaaataaaaaaataggagttataggaacagaagggaca
attgcaagcgggtcttttgaaaaaaagatattagagcttgatagtagcataaaggttttt
tcaaagccttgtcctctttttgttcctcttgtagaggaaggctggactgataaagaggta
acttatcttgttgctaaggagtacttagaagagtttatagagaaagaaatagatactctt
gttttagggtgtactcattatccttttctacaagatgtgataaaaaaggtattgccagat
gttatcctgataaatcctgcacgtgagacggcaaagagggtatttgaagtattaaaagag
aatgatatactaaatagttcctgtgaagaaccgacatattatttttatgcaagcgataat
ctcaaaaagtttgagtctgtagcttcaatatttttaaatgagaagataaagtgtgaagaa
aaaatagacattgagaaatactga

DBGET integrated database retrieval system