KEGG   Cupriavidus oxalaticus: E0W60_02005Help
Entry
E0W60_02005       CDS       T06004                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
cox  Cupriavidus oxalaticus
Pathway
cox00740  Riboflavin metabolism
cox00790  Folate biosynthesis
cox01100  Metabolic pathways
cox01110  Biosynthesis of secondary metabolites
cox02024  Quorum sensing
Module
cox_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:cox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    E0W60_02005 (ribA)
   00790 Folate biosynthesis
    E0W60_02005 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    E0W60_02005 (ribA)
Enzymes [BR:cox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     E0W60_02005 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 NinE
Motif
Other DBs
NCBI-ProteinID: QBY50020
UniProt: A0A4P7L417
Position
1:complement(459968..460564)
Genome map
AA seq 198 aa AA seqDB search
MNDTEIELIDSARLPTRFGDFTAHAFKGAHSGIEHLALSVGEVAGEDVLIRMHSECLTGD
VFGSCRCDCGPQLELAMEKIAAEGRGILLYLRGHEGRGIGLAEKIRAYRLQDGGLDTVDA
NLALGQAIDARNYAFAADLLHQWGVTSVRLMSNNPLKAAALEKAGIKVNEQLRHIVPSNA
ENEKYLATKRTRMGHLLD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacacagaaattgagctgatcgattcggcacgcctgccgacgcgatttggcgac
ttcacggcacacgccttcaagggcgcccactcgggtattgagcatctggccctgagcgtg
ggcgaagtggcaggcgaggacgtgctgatccgcatgcattccgaatgcctgaccggggat
gtcttcggttcctgccgctgcgattgcggcccgcagctcgagctggcgatggaaaagatc
gctgccgaaggccgcggcatcctgctgtacctgcgcggccacgaaggccgcggcatcggc
ctggcggagaagatccgcgcctaccgcctgcaggatggcgggctcgataccgtcgacgcc
aacctggcgctgggccaggccatcgacgcgcgcaactacgcctttgcggccgacctgctg
caccaatggggcgtcacgtcggtgcggctgatgagcaataacccgctcaaggccgccgcg
ctggaaaaggccggcatcaaggtcaacgagcaactgcggcacatcgtgccgtccaacgcc
gagaacgagaaatacctggcgaccaagcgcacgcgcatggggcacctgctcgactga

DBGET integrated database retrieval system