KEGG   Cupriavidus oxalaticus: E0W60_20840Help
Entry
E0W60_20840       CDS       T06004                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cox  Cupriavidus oxalaticus
Brite
KEGG Orthology (KO) [BR:cox00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    E0W60_20840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: QBY53527
UniProt: A0A4P7LL96
Position
2:complement(2165063..2166070)
Genome map
AA seq 335 aa AA seqDB search
MQTIQMSLWVIALLVALALLFDFMNGFHDAANSIATVVSTGVLKPHHAVAMAAMCNVVAI
FVFHLKVAATVGTGTIDVGIVDHYVIFGALVGAIAWNVITWYYGIPSSSSHALIGGLVGA
AVAKAGTGALVGSGLLKTVAFILISPFLGFVLGSIMMVMVGWTFFRTPPSRVDRWFRRLQ
LVSASLYSLGHGGNDAQKTIGIIWMLLIASGHVMAGGQPPTWVIVSCYVAIGMGTLFGGW
RIVRTMGQKITKLKPVGGFCAETGGALTLFFASALGVPVSTTHTITGAIVGVGSAQKMSA
VRWGVAGNIVWAWVLTIPASAFMAAIAWWIGRHIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattcaaatgagcctgtgggtgattgccctgctggtggcgctcgcgctgctg
ttcgacttcatgaacggcttccatgacgcggccaactcgatcgccacggtggtgtccacc
ggcgtgctcaagccgcaccatgcggtcgctatggcggcgatgtgcaacgtcgtcgccatc
ttcgtctttcacctgaaggtggcggccaccgtcggcaccggcaccatcgatgtcgggatc
gtcgaccactacgtcatcttcggcgccctggtcggggcgatcgcctggaacgtcattacc
tggtactacggcatcccgtcgtcgtcgtcgcacgcactgatcggcgggctggtcggagcg
gcggtggccaaggccggcaccggtgcgctggttggcagcggtctgctgaagacggtggcc
tttatcctgatctcgccgttcctgggtttcgtgcttggctcgatcatgatggtgatggtg
ggctggaccttcttccgcaccccgccgtcgcgtgtagaccgctggttccgccggctgcag
ctggtgtcggcctcgctgtacagcctgggccatggcggcaatgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccagtggccacgtgatggctggcggccaacccccg
acatgggtgatcgtgagctgctatgtggccatcggcatgggcacgctgttcggcggctgg
cgcatcgtgcgaaccatggggcagaagatcaccaagctcaagccggtgggcggcttctgt
gccgagaccgggggagcgctgacgctgttctttgcctcggcgctgggcgtgccggtatcg
accacgcatacgatcacaggggccatcgtcggcgtcggttcggcgcagaagatgtccgcg
gtgcgctggggcgtggccggcaatatcgtgtgggcctgggtgctgacgatcccggcatcg
gccttcatggcggcgatcgcatggtggatcgggcgccatatcctgtaa

DBGET integrated database retrieval system