KEGG   Cupriavidus oxalaticus: E0W60_26560Help
Entry
E0W60_26560       CDS       T06004                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cox  Cupriavidus oxalaticus
Pathway
cox03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cox00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    E0W60_26560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cox03011]
    E0W60_26560
Ribosome [BR:cox03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    E0W60_26560
  Bacteria
    E0W60_26560
  Archaea
    E0W60_26560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: QBY54550
UniProt: A0A4P7LET7
Position
2:complement(3399674..3400003)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIYVDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcgattcatcgcggtgcccgcatctccgcccagaagacgcgcctggtc
gctgaccagatccgtggtctgccgatcgagcgcgcgctcaatgtcctgacgttcagcccg
aaaaaggctgccgggattgtgaagaaggtggtcgaatcggccatcgccaacgctgagcac
aacgaaggcgccgacatcgacgaactcaaggtcaaatcgatctacgtcgacaaggcgacc
tcgctcaagcgcttcaccgcacgggcgaagggccgcggcaaccgcatcgagaaacaaacc
tgtcacatcactgtgacgctcggcaactaa

DBGET integrated database retrieval system