KEGG   Colwellia sp. PAMC 20917: A3Q34_04020Help
Entry
A3Q34_04020       CDS       T04511                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
coz  Colwellia sp. PAMC 20917
Brite
KEGG Orthology (KO) [BR:coz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:coz01002]
    A3Q34_04020
Enzymes [BR:coz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     A3Q34_04020
Peptidases [BR:coz01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   A3Q34_04020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: AOW76090
UniProt: A0A1D8RSL7
Position
940789..942876
Genome map
AA seq 695 aa AA seqDB search
MKLSKISAALAAVLAFSGCSEQEASGNKVEPKQTHQATATSNNEFKWQVDRFADIRVIRY
QVPGFEELPLETKELLFYLYKAALSGRDITWDHNYKYNLTIRHTLEAVIADYAGDKSSEE
FKKFNEYTKRVWFSNGIHHHYMSGKLSPEFSPETFERYVMSVAEKGKLPLNKDQSAEQLV
ALLTPILFDPTVAPKMVNQSANIDNVVASSVNYYEGVTEQEVEDFYKNKVDVDPKRPVSW
GLNSKLVKIDGKIVEQVWKVGGMYDKAISEIVFWLDKAATVAENDQQRKALTLLSKYYKS
GDLKDFDDYSIAWVKDVNSDVDVVNGFIEVYDDPLAYRGSFESVVSVKDHEATKVIAKIA
AEAQWFEDNSPLIESHKKKEVKGITGKAITVVIESGDASPSTPIGINLPNANWIRAEHGS
KSVSLTNIVSAYDNVKGGSLAEFVWDDAELARSKAFGPLASHLHTDLHEVVGHASGQINE
GVGTPKETLKQYSSALEEGRADLIALYYLMDQKLIDMGAMPSLEVGKASYDSYIRNGMML
QLRRLKEGEQIEEAHMRNRQLIASWAFEKGATDNVIEKRVRDGKTFFVVNDYQKLRTLFG
QLLRELQRIKSEGDFAAGQALIEGYAVKVDKKLHLEVLSRYEKLNLAPYSGFVNPKLEAV
YLGDKMTNVKITYPDNFQEQMLEYGKDYGLLPVLN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcaaaaatatctgcagcgttagcagctgtactcgctttttctggctgctct
gaacaagaagcaagcggcaataaagtagagccaaagcaaactcatcaagcgacagcaact
agcaacaatgaatttaaatggcaggtagaccgttttgctgatatccgtgttatacgttat
caagtacctggttttgaagaattgcctctagaaactaaagaattgttattttatctctat
aaagcagcgctttctggtcgtgatatcacttgggatcataactacaaatacaacctcacc
attcgtcatacgttagaagcggttatcgctgattatgccggagacaaaagcagcgaagaa
ttcaaaaagttcaatgaatacactaaacgtgtttggttttctaacggtattcatcaccat
tatatgtcaggtaaattgagccctgaatttagccctgaaacttttgaacgctatgtcatg
tcagttgccgaaaaaggtaaattacccttaaataaagaccaaagtgctgagcagttagtg
gccttactaacacctattctattcgacccaacggtcgcacctaaaatggttaatcagtct
gctaacattgataatgttgttgcctcttccgttaactattatgaaggcgttaccgaacaa
gaagttgaagacttttataaaaacaaggtcgatgtagaccctaagcgtcccgtatcttgg
ggtttgaattctaaattagtaaaaattgacggcaagatagttgaacaagtgtggaaagtg
ggtggtatgtacgataaagccattagtgaaattgtcttttggctagataaagcagcaacc
gttgctgaaaacgatcaacaacgtaaagccctaaccttgttatcgaaatactataaaagc
ggcgatttaaaagactttgacgactactctattgcgtgggttaaagacgttaattcagat
gttgacgtagtaaatggttttatcgaggtttacgacgatcctctagcttacagaggttca
tttgaatccgttgtttcggtaaaagatcacgaagcgaccaaagtgatcgctaagattgcc
gcagaagctcagtggtttgaagataattcaccactcattgaaagccataagaaaaaagaa
gtcaaaggtattaccggtaaagccattaccgttgttattgagtctggcgatgcttctcct
tcaacgcctattggcattaacttacccaacgctaactggatacgcgctgagcatggttca
aagtcggtaagcttaaccaatattgttagtgcttatgacaacgtaaaaggtggttcatta
gccgaatttgtttgggacgatgctgaacttgcgcgcagcaaagcatttggtccgttagcg
tctcacttgcataccgatttacatgaagttgttggtcatgcttcggggcaaattaacgaa
ggcgttggcacacctaaagaaaccttaaagcaatattcgtcagcccttgaagaaggtcgc
gccgacttaattgccttgtactatcttatggatcaaaaattaattgatatgggtgcaatg
ccaagcttagaagtgggtaaagcaagctacgacagttatattcgtaacggcatgatgttg
caattacgacgtctcaaagagggtgagcaaattgaagaagcacacatgcgtaaccgtcag
ttaattgcaagttgggcatttgaaaaaggtgccactgacaatgttattgaaaagcgagtc
cgtgatggaaaaactttttttgttgtcaacgactatcaaaagctacggacattatttggc
caattattacgtgaattacaacgaataaagtctgaaggtgactttgctgcaggccaagct
ttaattgagggttacgccgttaaggttgacaaaaaattacacttagaagtgttgagccgt
tatgagaaacttaacttagcaccatattctggttttgttaaccctaaattagaagccgta
tatctaggtgataaaatgactaatgtaaaaatcacttaccctgataacttccaagagcag
atgttggaatatggtaaagattatgggttattacccgttctaaactaa

DBGET integrated database retrieval system