KEGG   Colwellia sp. PAMC 20917: A3Q34_05640Help
Entry
A3Q34_05640       CDS       T04511                                 

Gene name
rluD
Definition
(GenBank) 23S rRNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
coz  Colwellia sp. PAMC 20917
Brite
KEGG Orthology (KO) [BR:coz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:coz03009]
    A3Q34_05640 (rluD)
Enzymes [BR:coz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A3Q34_05640 (rluD)
Ribosome biogenesis [BR:coz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A3Q34_05640 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AOW76384
UniProt: A0A1D8RTF0
Position
complement(1326563..1327540)
Genome map
AA seq 325 aa AA seqDB search
MAEIIQHTDTVPETCLGKRFDQTLAEMFPEYSRSRIKEWILAGHVTLNGAILIIPREKMF
GGEVIKISTEVEGDVRFEPQNIPLNIVYEDDDIIVINKPAGFVVHPGAGNPDGTVLNALL
YHCPQLDVVPRAGIVHRLDKDTTGLMVIAKTIAAQTNLVDAIQEREITREYEAIANGLMT
AGGMVDEPIGRHSTKRTHMAVSPFGRPSVTHYRVMEKFRLHTRLRLRLETGRTHQIRVHM
AHITHPLIGDPNYGGRPRPPKNATEDLRDLLRSFKRQALHAAMLSLFHPITGEEMTWHAP
IPDDMVNLTNVLREDSKINATDDYL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaataattcaacatacagatacggttcctgaaacttgtttaggtaaacgattc
gaccaaacattagctgagatgttccctgaatattctcgttctcgcataaaagaatggatc
ttagcaggtcacgttactttaaacggcgctattttgataataccacgcgagaaaatgttt
ggcggggaggtgatcaaaatatcaactgaagttgaaggcgacgtgcgatttgaaccacaa
aatattcctttaaatattgtttatgaagatgacgatattatagttattaataaacctgct
ggttttgtagttcacccaggtgcaggtaatcctgatggcacggtacttaatgctttattg
tatcattgcccacagcttgatgttgtccctcgtgccggcatcgtccacagactagataaa
gatacaacgggtttgatggttattgctaaaacaattgcagcgcaaacaaacttagtcgat
gctatacaagaacgtgaaataacgcgtgaatatgaagcgattgctaatggtctaatgaca
gctggtggtatggttgatgaacctataggtcgccattcaaccaaaagaacacacatggct
gttagtccttttggacgtccatcggtaacgcattatcgtgtaatggaaaaattccgttta
cacacacgtttaagattacgtcttgaaacgggtcgtacgcatcaaattcgtgttcatatg
gcgcatattacccatccattgattggagatcctaattacggtggtcgtcctcgtcctcct
aaaaatgcgacagaagatttgcgggatttattgcgtagttttaagcgccaagcattacat
gcggcaatgttgtcattatttcaccctataacgggtgaagaaatgacttggcatgcacct
attccagatgacatggttaatttaacaaatgttttgcgtgaagattcgaaaatcaacgca
acagacgactatttataa

DBGET integrated database retrieval system