KEGG   Colwellia sp. PAMC 20917: A3Q34_13030Help
Entry
A3Q34_13030       CDS       T04511                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
coz  Colwellia sp. PAMC 20917
Brite
KEGG Orthology (KO) [BR:coz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A3Q34_13030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 DUF4139
Motif
Other DBs
NCBI-ProteinID: AOW79113
UniProt: A0A1D8S198
Position
3020420..3020791
Genome map
AA seq 123 aa AA seqDB search
MGYDISVSVKTEYIASQLIENEKNYVFSYTISIANNSNKPVKLLSRYWLITDGDNKTSTV
AGEGVIGKQPIIAPDNTYTYTSGCILKTPVGTMQGHYQMLSDDKDLQQVEIPVFGLAQPH
ILN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgggatatgatatttcggtcagcgttaaaactgagtatattgcctcacaattgattgaa
aacgaaaagaactatgtatttagttatacgattagtattgccaataatagtaataaaccg
gttaaattattgtctcgttattggttgattaccgatggtgacaataagacctctaccgtt
gccggtgaaggtgttattggtaagcaaccgatcatagcgccagacaacacgtacacttat
accagtggttgtatcttaaaaaccccggtcggtactatgcagggccattaccaaatgcta
agtgatgataaagacttgcaacaagttgaaatacctgtttttggtttagctcagccgcac
attcttaactaa

DBGET integrated database retrieval system