KEGG   Colwellia sp. PAMC 20917: A3Q34_13635Help
Entry
A3Q34_13635       CDS       T04511                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
coz  Colwellia sp. PAMC 20917
Pathway
coz00620  Pyruvate metabolism
coz00630  Glyoxylate and dicarboxylate metabolism
coz01100  Metabolic pathways
coz01110  Biosynthesis of secondary metabolites
coz01120  Microbial metabolism in diverse environments
coz01200  Carbon metabolism
Module
coz_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:coz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3Q34_13635
   00630 Glyoxylate and dicarboxylate metabolism
    A3Q34_13635
Enzymes [BR:coz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     A3Q34_13635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Mitoc_L55 SLATT_1 Lant_dehydr_N
Motif
Other DBs
NCBI-ProteinID: AOW77795
UniProt: A0A1D8RXH0
Position
complement(3174989..3177169)
Genome map
AA seq 726 aa AA seqDB search
MTPYIKIQNIQVAQCLHQFIEQDVLPHSLIPPTDFWQNFSTIIEKLTPINKALLATRDDL
QTKIDSWHQNNFADNFDFSSYKKFLKDINYLVPEVEDFAITTENVDAELATMAGPQLVVP
IMNARFAINAVNARWGSLYDALYGSDVISAENGAENAGGYNAVRGQKVIEFARQFLDQSI
PLTAGSHAQAKHYNVSDAFLTVTLESGETVKLENGDAFKGYQGTVDAPTALLFEHNGLHF
EINFDESSVIAKSDKAGISDITLESALTTIMDCEDSVAAVDADDKVVAYKNWLGLMQGNL
TTDLVKNGKTIQRTMAVDRQYHQTDGANLTLKGRSLMFVRNVGHLMTNNAILLADGSEVP
EGIIDAMVTSLIASLNLQQTAAAESFCNSAEKSIYIVKPKMHGPEEVAFANTLFEQVEDA
LALTRNTIKMGIMDEERRTSVNLKACIAQAKSRVVFINTGFLDRTGDEIHTSMAAGIMAK
KADIKLTPWISAYEDNNVDVGLACGFSGRAQIGKGMWPIPDQMLNMLATKINHVQAGANT
AWVPSPTAATLHALHYHRENVFALQKKLMLRTPANLDDILTIPLAKDTNWSEQEISDELD
NNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHMANWMKHEVCSEQQVL
ASLKKMAKTVDSQNKNDANYQPMASNFEKSIAFKAACDLVFLGTTQVNGYTEPLLHSYRL
KVKQLS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgtacataaagatccaaaatatccaagtagcgcaatgtttacatcaatttatt
gaacaggatgtacttcctcatagcctaattccaccaactgacttttggcaaaacttctca
acaatcattgaaaaattaacacctattaataaagctttgttagcaacacgtgatgattta
caaacgaaaatagatagctggcaccagaataactttgccgataacttcgatttttcatca
tacaaaaaatttctaaaagacatcaattacctggtacctgaggttgaagactttgccata
acaaccgaaaatgtagatgctgagttagcaacaatggcgggcccgcaactcgtggtacca
ataatgaacgctaggtttgccattaacgccgttaatgctcgttggggaagcttgtatgat
gccctttatggtagcgatgttatttctgcagaaaatggggctgaaaacgctggtggctat
aatgccgttcgtggtcaaaaagtcattgaatttgcgcgacaatttttagatcaaagtatt
ccattaactgctggcagtcacgcccaagcgaagcactacaacgtatctgatgctttttta
acggttacacttgaaagtggcgaaaccgttaaacttgaaaacggcgatgcttttaaaggt
tatcaaggcacagtagatgcaccgaccgcgctattatttgaacataatggtttacacttt
gaaattaactttgatgaaagtagtgttatcgcaaaaagcgataaagcaggcatttctgac
atcactcttgagtcggctttaacgaccattatggattgtgaagactctgtcgcagccgtt
gatgccgatgataaagtggtcgcttataaaaactggttggggttaatgcaaggtaactta
accactgacttagtaaaaaatggtaaaactattcagcgcactatggcggttgacagacag
tatcatcaaactgatggcgcgaatttaacgctaaaaggccgtagtttaatgtttgtccgt
aatgtcgggcatttaatgacgaacaatgccatcttattagctgatggctctgaagtgcca
gaaggtattattgatgccatggtaacctcactaatcgctagtctcaatttacaacaaacc
gcagctgctgagtcattttgtaatagtgcagaaaaatcaatttatattgttaaaccaaaa
atgcatggcccagaagaggtcgcttttgctaatacattatttgaacaagtcgaagatgct
ttagcgttaacaagaaacaccataaaaatgggcataatggatgaagagcgccgaacaagc
gttaatttaaaggcttgtatcgctcaagctaagtctcgtgtggtctttattaacactgga
tttttagaccgtaccggtgatgaaattcatacatcaatggcggcaggtattatggctaaa
aaagcagatataaagttaacaccttggataagcgcttatgaagataataacgttgatgtc
ggcttagcctgtggctttagtggcagagcacaaattggtaagggcatgtggcccattcct
gatcaaatgttgaatatgttagctactaaaattaatcacgtacaagcaggggcaaataca
gcttgggtaccttctcctacagcagcaaccctgcacgctttacattatcatagagagaat
gttttcgcgctgcagaaaaagttaatgctacgtactccggctaacttagatgatatctta
acgatcccactcgccaaagacaccaactggagtgagcaggagatctctgatgaactcgat
aataacgctcagggtattttaggctatgttgtacgatggattgatcaaggtgtcggttgt
tcaaaagttcctgatattaataatgtcggtttaatggaagacagagcaactttacgtatc
tccagtcaacatatggccaattggatgaagcatgaggtttgtagtgaacaacaagtatta
gccagtttgaaaaagatggctaaaactgttgatagccaaaataaaaatgatgctaactat
caaccaatggcaagtaactttgaaaagagtatcgcttttaaagcggcttgtgatttagta
tttttaggcacaacacaagttaatggttataccgaacctttattacatagttaccgacta
aaagtgaagcaactcagttaa

DBGET integrated database retrieval system